Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54576
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A8
Synonyms (NCBI Gene) Gene synonyms aliases	GNT1, UDPGT, UDPGT 1-1, UDPGT 1-8, UGT-1A, UGT-1H, UGT1, UGT1-01, UGT1-08, UGT1.1, UGT1.8, UGT1A, UGT1A1, UGT1A8S, UGT1H, hUG-BR1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473517	hsa-miR-1202	CLIP-seq
MIRT1473518	hsa-miR-136	CLIP-seq
MIRT1473519	hsa-miR-3120-5p	CLIP-seq
MIRT1473520	hsa-miR-3130-3p	CLIP-seq
MIRT1473521	hsa-miR-3194-5p	CLIP-seq
MIRT1473522	hsa-miR-346	CLIP-seq
MIRT1473523	hsa-miR-3909	CLIP-seq
MIRT1473524	hsa-miR-3940-5p	CLIP-seq
MIRT1473525	hsa-miR-3972	CLIP-seq
MIRT1473526	hsa-miR-4288	CLIP-seq
MIRT1473527	hsa-miR-4421	CLIP-seq
MIRT1473528	hsa-miR-4507	CLIP-seq
MIRT1473529	hsa-miR-4766-5p	CLIP-seq
MIRT1473530	hsa-miR-4793-3p	CLIP-seq
MIRT1473531	hsa-miR-489	CLIP-seq
MIRT1473532	hsa-miR-514	CLIP-seq
MIRT1473533	hsa-miR-514b-3p	CLIP-seq
MIRT1473534	hsa-miR-548a-5p	CLIP-seq
MIRT1473535	hsa-miR-548ab	CLIP-seq
MIRT1473536	hsa-miR-548ak	CLIP-seq
MIRT1473537	hsa-miR-548b-5p	CLIP-seq
MIRT1473538	hsa-miR-548c-5p	CLIP-seq
MIRT1473539	hsa-miR-548d-5p	CLIP-seq
MIRT1473540	hsa-miR-548h	CLIP-seq
MIRT1473541	hsa-miR-548i	CLIP-seq
MIRT1473542	hsa-miR-548j	CLIP-seq
MIRT1473543	hsa-miR-548n	CLIP-seq
MIRT1473544	hsa-miR-548w	CLIP-seq
MIRT1473545	hsa-miR-548y	CLIP-seq
MIRT1473546	hsa-miR-559	CLIP-seq
MIRT1473547	hsa-miR-629	CLIP-seq
MIRT1473548	hsa-miR-632	CLIP-seq
MIRT2142606	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CDX2	Activation	15044625
HNF1A	Activation	15044625

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IC	20308471
GO:0004857	Function	Enzyme inhibitor activity	IDA	19996319
GO:0005496	Function	Steroid binding	IDA	19996319
GO:0005504	Function	Fatty acid binding	IDA	19996319
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006631	Process	Fatty acid metabolic process	IC	19996319
GO:0008202	Process	Steroid metabolic process	IC	19996319
GO:0008202	Process	Steroid metabolic process	IDA	15472229, 16595710, 23288867
GO:0009804	Process	Coumarin metabolic process	IC	19996319
GO:0015020	Function	Glucuronosyltransferase activity	IDA	18052087, 19996319, 20056724, 20308471
GO:0016021	Component	Integral component of membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IC	19996319
GO:0045939	Process	Negative regulation of steroid metabolic process	IC	19996319
GO:0051552	Process	Flavone metabolic process	IDA	18052087
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052696	Process	Flavonoid glucuronidation	IDA	20056724
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IDA	20056724

MIM	HGNC	e!Ensembl
606433	12540	ENSG00000242366

Protein

UniProt ID

Q9HAW9

Protein name

UDP-glucuronosyltransferase 1A8 (UGT1A8) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-8) (UDPGT 1-8) (UGT1*8) (UGT1-08) (UGT1.8) (UDP-glucuronosyltransferase 1-H) (UGT-1H) (UGT1H)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in kidney, colon and small intestine (PubMed:18004212). Not expressed in liver (PubMed:18004212). {ECO:0000269|PubMed:18004212}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in liver, kidney, colon and small intes

Sequence

MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	15712364, 26697581, 11182932
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Attention Deficit Hyperactivity Disorder	Attention Deficit Hyperactivity Disorder	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	21750172, 34886806
Carcinoma Hepatocellular	Associate	34147074
Colorectal Neoplasms	Inhibit	31740522
Esophageal Neoplasms	Associate	22367021
Esophageal Squamous Cell Carcinoma	Associate	22367021
Gastroschisis	Associate	31075877
Stomach Neoplasms	Stimulate	25712374

UGT1A8 (UDP glucuronosyltransferase family 1 member A8)