Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54575
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A10
Synonyms (NCBI Gene) Gene synonyms aliases	GNT1, UDPGT, UGT-1A, UGT-1J, UGT1, UGT1-01, UGT1-10, UGT1.1, UGT1.10, UGT1A, UGT1A1, UGT1J, hUG-BR1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022953	hsa-miR-124-3p	Microarray	18668037
MIRT1473293	hsa-miR-1202	CLIP-seq
MIRT1473294	hsa-miR-136	CLIP-seq
MIRT1473295	hsa-miR-3120-5p	CLIP-seq
MIRT1473296	hsa-miR-3130-3p	CLIP-seq
MIRT1473297	hsa-miR-3194-5p	CLIP-seq
MIRT1473298	hsa-miR-346	CLIP-seq
MIRT1473299	hsa-miR-3909	CLIP-seq
MIRT1473300	hsa-miR-3940-5p	CLIP-seq
MIRT1473301	hsa-miR-3972	CLIP-seq
MIRT1473302	hsa-miR-4288	CLIP-seq
MIRT1473303	hsa-miR-4421	CLIP-seq
MIRT1473304	hsa-miR-4507	CLIP-seq
MIRT1473305	hsa-miR-4766-5p	CLIP-seq
MIRT1473306	hsa-miR-4793-3p	CLIP-seq
MIRT1473307	hsa-miR-489	CLIP-seq
MIRT1473308	hsa-miR-514	CLIP-seq
MIRT1473309	hsa-miR-514b-3p	CLIP-seq
MIRT1473310	hsa-miR-548a-5p	CLIP-seq
MIRT1473311	hsa-miR-548ab	CLIP-seq
MIRT1473312	hsa-miR-548ak	CLIP-seq
MIRT1473313	hsa-miR-548b-5p	CLIP-seq
MIRT1473314	hsa-miR-548c-5p	CLIP-seq
MIRT1473315	hsa-miR-548d-5p	CLIP-seq
MIRT1473316	hsa-miR-548h	CLIP-seq
MIRT1473317	hsa-miR-548i	CLIP-seq
MIRT1473318	hsa-miR-548j	CLIP-seq
MIRT1473319	hsa-miR-548n	CLIP-seq
MIRT1473320	hsa-miR-548w	CLIP-seq
MIRT1473321	hsa-miR-548y	CLIP-seq
MIRT1473322	hsa-miR-559	CLIP-seq
MIRT1473323	hsa-miR-629	CLIP-seq
MIRT1473324	hsa-miR-632	CLIP-seq
MIRT2142599	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CDX2	Activation	15044625
HNF1A	Activation	15044625

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0005080	Function	Protein kinase C binding	IDA	18556656
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145, 18556656
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0015020	Function	Glucuronosyltransferase activity	IDA	18052087, 20056724
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0051552	Process	Flavone metabolic process	IDA	18052087
GO:0052695	Process	Cellular glucuronidation	IDA	20056724
GO:0052695	Process	Cellular glucuronidation	TAS
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635

MIM	HGNC	e!Ensembl
606435	12531	ENSG00000242515

Protein

UniProt ID

Q9HAW8

Protein name

UDP-glucuronosyltransferase 1A10 (UGT1A10) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-10) (UDPGT 1-10) (UGT1*10) (UGT1-10) (UGT1.10) (UDP-glucuronosyltransferase 1-J) (UGT-1J) (UGT1J)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Liver and colon (PubMed:9271343). Isoform 1 and isoform 2 are expressed in colon, esophagus and small intestine; isoform 2 but not isoform 1 is expressed in liver or kidney (PubMed:18004212). {ECO:0000269|PubMed:18004212, ECO:0000269|P

Sequence

MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEG
AQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	26697581, 15712364, 11182932
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Attention Deficit Hyperactivity Disorder	Attention Deficit Hyperactivity Disorder	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Inhibit	18374377
Breast Neoplasms	Associate	34886806
Carcinoma Squamous Cell	Associate	10024527
Colorectal Neoplasms	Associate	24822274, 31740522
Drug Related Side Effects and Adverse Reactions	Associate	23160818
Environmental Illness	Associate	10024527
Esophageal Squamous Cell Carcinoma	Associate	10024527
Gastroschisis	Associate	31075877
Neoplasms	Associate	12910533, 24822274
Pancreatic Neoplasms	Associate	34660806
Stomach Neoplasms	Stimulate	25712374

UGT1A10 (UDP glucuronosyltransferase family 1 member A10)