Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5457
Gene name Gene Name - the full gene name approved by the HGNC.	POU class 4 homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	POU4F1
Synonyms (NCBI Gene) Gene synonyms aliases	ATITHS, BRN3A, Oct-T1, RDC-1, brn-3A
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervi

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030102	hsa-miR-26b-5p	Microarray	19088304
MIRT046165	hsa-miR-30b-5p	CLASH	23622248
MIRT1250995	hsa-miR-1185	CLIP-seq
MIRT1250996	hsa-miR-1246	CLIP-seq
MIRT1250997	hsa-miR-1276	CLIP-seq
MIRT1250998	hsa-miR-132	CLIP-seq
MIRT1250999	hsa-miR-2052	CLIP-seq
MIRT1251000	hsa-miR-212	CLIP-seq
MIRT1251001	hsa-miR-2467-3p	CLIP-seq
MIRT1251002	hsa-miR-3121-5p	CLIP-seq
MIRT1251003	hsa-miR-3125	CLIP-seq
MIRT1251004	hsa-miR-3127-3p	CLIP-seq
MIRT1251005	hsa-miR-3140-3p	CLIP-seq
MIRT1251006	hsa-miR-3201	CLIP-seq
MIRT1251007	hsa-miR-3612	CLIP-seq
MIRT1251008	hsa-miR-3663-5p	CLIP-seq
MIRT1251009	hsa-miR-3679-5p	CLIP-seq
MIRT1251010	hsa-miR-3685	CLIP-seq
MIRT1251011	hsa-miR-375	CLIP-seq
MIRT1251012	hsa-miR-384	CLIP-seq
MIRT1251013	hsa-miR-3916	CLIP-seq
MIRT1251014	hsa-miR-3943	CLIP-seq
MIRT1251015	hsa-miR-4261	CLIP-seq
MIRT1251016	hsa-miR-4273	CLIP-seq
MIRT1251017	hsa-miR-4307	CLIP-seq
MIRT1251018	hsa-miR-4311	CLIP-seq
MIRT1251019	hsa-miR-4496	CLIP-seq
MIRT1251020	hsa-miR-4511	CLIP-seq
MIRT1251021	hsa-miR-455-3p	CLIP-seq
MIRT1251022	hsa-miR-4652-3p	CLIP-seq
MIRT1251023	hsa-miR-4677-5p	CLIP-seq
MIRT1251024	hsa-miR-4791	CLIP-seq
MIRT1251025	hsa-miR-548b-3p	CLIP-seq
MIRT1251026	hsa-miR-583	CLIP-seq
MIRT1251027	hsa-miR-595	CLIP-seq
MIRT1251028	hsa-miR-650	CLIP-seq
MIRT1251029	hsa-miR-935	CLIP-seq
MIRT2074091	hsa-miR-1305	CLIP-seq
MIRT1251011	hsa-miR-375	CLIP-seq
MIRT1251016	hsa-miR-4273	CLIP-seq
MIRT1251022	hsa-miR-4652-3p	CLIP-seq
MIRT1251023	hsa-miR-4677-5p	CLIP-seq
MIRT2074092	hsa-miR-579	CLIP-seq
MIRT2301092	hsa-miR-151-3p	CLIP-seq
MIRT2301093	hsa-miR-2682	CLIP-seq
MIRT2301094	hsa-miR-3689d	CLIP-seq
MIRT2301095	hsa-miR-411	CLIP-seq
MIRT2301096	hsa-miR-4463	CLIP-seq
MIRT2301097	hsa-miR-4499	CLIP-seq
MIRT2301098	hsa-miR-449c	CLIP-seq
MIRT2301099	hsa-miR-4514	CLIP-seq
MIRT2301100	hsa-miR-4692	CLIP-seq
MIRT2074092	hsa-miR-579	CLIP-seq
MIRT2301101	hsa-miR-936	CLIP-seq
MIRT2456943	hsa-miR-1972	CLIP-seq
MIRT2456944	hsa-miR-3667-3p	CLIP-seq
MIRT2456945	hsa-miR-3679-3p	CLIP-seq
MIRT2456946	hsa-miR-4286	CLIP-seq
MIRT2456947	hsa-miR-4700-3p	CLIP-seq
MIRT2456948	hsa-miR-4717-5p	CLIP-seq
MIRT2456943	hsa-miR-1972	CLIP-seq
MIRT2456947	hsa-miR-4700-3p	CLIP-seq
MIRT2456948	hsa-miR-4717-5p	CLIP-seq
MIRT2597662	hsa-miR-1293	CLIP-seq
MIRT2456943	hsa-miR-1972	CLIP-seq
MIRT2597663	hsa-miR-3123	CLIP-seq
MIRT2597664	hsa-miR-3919	CLIP-seq
MIRT1251018	hsa-miR-4311	CLIP-seq
MIRT2597665	hsa-miR-4483	CLIP-seq
MIRT2597666	hsa-miR-4506	CLIP-seq
MIRT2456947	hsa-miR-4700-3p	CLIP-seq
MIRT2456948	hsa-miR-4717-5p	CLIP-seq
MIRT2597667	hsa-miR-4756-3p	CLIP-seq
MIRT2597668	hsa-miR-765	CLIP-seq
MIRT2456943	hsa-miR-1972	CLIP-seq
MIRT2456947	hsa-miR-4700-3p	CLIP-seq
MIRT2456948	hsa-miR-4717-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
EWSR1	Unknown	15021903

Show/Hide all(95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	18421303
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	23805044
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	18421303
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	18421303
GO:0001764	Process	Neuron migration	IEA
GO:0001967	Process	Suckling behavior	IEA
GO:0003223	Process	Ventricular compact myocardium morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	TAS	8995448, 17239249
GO:0007416	Process	Synapse assembly	TAS	8995448
GO:0007498	Process	Mesoderm development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0021535	Process	Cell migration in hindbrain	IEA
GO:0021559	Process	Trigeminal nerve development	IEA
GO:0021559	Process	Trigeminal nerve development	ISS
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021986	Process	Habenula development	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0043005	Component	Neuron projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS	18421303
GO:0043069	Process	Negative regulation of programmed cell death	IEA
GO:0043069	Process	Negative regulation of programmed cell death	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	TAS	17239249
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23805044
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23805044
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	18421303
GO:0048665	Process	Neuron fate specification	IEA
GO:0048665	Process	Neuron fate specification	ISS
GO:0048880	Process	Sensory system development	IEA
GO:0048880	Process	Sensory system development	ISS
GO:0048934	Process	Peripheral nervous system neuron differentiation	IEA
GO:0048935	Process	Peripheral nervous system neuron development	IEA
GO:0048935	Process	Peripheral nervous system neuron development	ISS
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0051020	Function	GTPase binding	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	ISS
GO:0051355	Process	Proprioception involved in equilibrioception	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS	18421303
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0060384	Process	Innervation	IEA
GO:0060384	Process	Innervation	TAS	17239249
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	ISS
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	ISS
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	ISS

MIM	HGNC	e!Ensembl
601632	9218	ENSG00000152192

Protein

UniProt ID

Q01851

Protein name

POU domain, class 4, transcription factor 1 (Brain-specific homeobox/POU domain protein 3A) (Brain-3A) (Brn-3A) (Homeobox/POU domain protein RDC-1) (Oct-T1)

Protein function

Multifunctional transcription factor with different regions mediating its different effects. Acts by binding (via its C-terminal domain) to sequences related to the consensus octamer motif 5'-ATGCAAAT-3' in the regulatory regions of its target g

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00157	Pou	263 → 337	Pou domain - N-terminal to homeobox domain	Domain
PF00046	Homeodomain	356 → 412	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain and the retina. Present in the developing brain, spinal cord and eye. {ECO:0000269|PubMed:1357630, ECO:0000269|PubMed:7623109}.

Sequence

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEA
LAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHI
SSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGG
GLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQV
AAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPG
VGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRT
SIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Sequence length

419

Interactions

View interactions

	Reactome
			Regulation of TP53 Activity through Association with Co-factors

POU4F1 (POU class 4 homeobox 1)