Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54546
Gene name	Ring finger protein 186
Gene symbol	RNF186
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p36.13

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017282	hsa-miR-335-5p	Microarray	18185580
MIRT1311626	hsa-miR-142-5p	CLIP-seq
MIRT1311627	hsa-miR-145	CLIP-seq
MIRT1311628	hsa-miR-186	CLIP-seq
MIRT1311629	hsa-miR-3133	CLIP-seq
MIRT1311630	hsa-miR-340	CLIP-seq
MIRT1311631	hsa-miR-410	CLIP-seq
MIRT1311632	hsa-miR-518a-5p	CLIP-seq
MIRT1311633	hsa-miR-527	CLIP-seq
MIRT1311634	hsa-miR-548aa	CLIP-seq
MIRT1311635	hsa-miR-548ac	CLIP-seq
MIRT1311636	hsa-miR-548d-3p	CLIP-seq
MIRT1311637	hsa-miR-548z	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	23896122
GO:0005515	Function	Protein binding	IPI	23896122, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	23896122
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	23896122
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	23896122
GO:0035519	Process	Protein K29-linked ubiquitination	IBA
GO:0035519	Process	Protein K29-linked ubiquitination	IDA	23896122
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23896122
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IBA
GO:0051865	Process	Protein autoubiquitination	IDA	23896122
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	33280498
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	23896122
GO:0070534	Process	Protein K63-linked ubiquitination	IBA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	23896122
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0070585	Process	Protein localization to mitochondrion	IBA
GO:0070585	Process	Protein localization to mitochondrion	IMP	23896122
GO:0140208	Process	Apoptotic process in response to mitochondrial fragmentation	IDA	29222049
GO:2000785	Process	Regulation of autophagosome assembly	IDA	33280498

MIM	HGNC	e!Ensembl
617163	25978	ENSG00000178828

Q9NXI6

Protein name

E3 ubiquitin-protein ligase RNF186 (EC 2.3.2.27) (RING finger protein 186)

Protein function

E3 ubiquitin protein ligase that is part of an apoptotic signaling pathway activated by endoplasmic reticulum stress (PubMed:23896122). Stimulates the expression of proteins specific of the unfolded protein response (UPR), ubiquitinates BNIP1 an

Family and domains

Sequence

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQH
AFCAICLKLLLCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCP
QGLVDPADLAAGHPSLVGEDGQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRW
VLTFIIALALLMSTLFCCLPSTRGSCWPSSRTLFCREQKHSHISSIA

Sequence length

227

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Inhibit	38160786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	21304977, 24068945, 27503255	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	21304977, 24068945	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	38160786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	34353900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	38160786	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF186 (ring finger protein 186)