Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54543
Gene name	Translocase of outer mitochondrial membrane 7
Gene symbol	TOMM7
Synonyms (NCBI Gene)	GMPGSTOM7
Chromosome	7
Chromosome location	7p15.3
Summary	This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex. [provided by RefSeq, Oct 2012]

172

Show/Hide all (172)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040020	hsa-miR-615-3p	CLASH	23622248
MIRT1446947	hsa-miR-106a	CLIP-seq
MIRT1446948	hsa-miR-106b	CLIP-seq
MIRT1446949	hsa-miR-1227	CLIP-seq
MIRT1446950	hsa-miR-134	CLIP-seq
MIRT1446951	hsa-miR-150	CLIP-seq
MIRT1446952	hsa-miR-155	CLIP-seq
MIRT1446953	hsa-miR-17	CLIP-seq
MIRT1446954	hsa-miR-194	CLIP-seq
MIRT1446955	hsa-miR-20a	CLIP-seq
MIRT1446956	hsa-miR-20b	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446959	hsa-miR-2467-3p	CLIP-seq
MIRT1446960	hsa-miR-2964a-5p	CLIP-seq
MIRT1446961	hsa-miR-29a	CLIP-seq
MIRT1446962	hsa-miR-29b	CLIP-seq
MIRT1446963	hsa-miR-29c	CLIP-seq
MIRT1446964	hsa-miR-302a	CLIP-seq
MIRT1446965	hsa-miR-302b	CLIP-seq
MIRT1446966	hsa-miR-302c	CLIP-seq
MIRT1446967	hsa-miR-302d	CLIP-seq
MIRT1446968	hsa-miR-302e	CLIP-seq
MIRT1446969	hsa-miR-3118	CLIP-seq
MIRT1446970	hsa-miR-3136-5p	CLIP-seq
MIRT1446971	hsa-miR-3152-5p	CLIP-seq
MIRT1446972	hsa-miR-3154	CLIP-seq
MIRT1446973	hsa-miR-3176	CLIP-seq
MIRT1446974	hsa-miR-329	CLIP-seq
MIRT1446975	hsa-miR-3611	CLIP-seq
MIRT1446976	hsa-miR-362-3p	CLIP-seq
MIRT1446977	hsa-miR-3669	CLIP-seq
MIRT1446978	hsa-miR-3678-3p	CLIP-seq
MIRT1446979	hsa-miR-372	CLIP-seq
MIRT1446980	hsa-miR-373	CLIP-seq
MIRT1446981	hsa-miR-3922-3p	CLIP-seq
MIRT1446982	hsa-miR-3941	CLIP-seq
MIRT1446983	hsa-miR-4312	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT1446985	hsa-miR-4438	CLIP-seq
MIRT1446986	hsa-miR-4439	CLIP-seq
MIRT1446987	hsa-miR-4513	CLIP-seq
MIRT1446988	hsa-miR-4653-3p	CLIP-seq
MIRT1446989	hsa-miR-4677-3p	CLIP-seq
MIRT1446990	hsa-miR-4679	CLIP-seq
MIRT1446991	hsa-miR-4709-3p	CLIP-seq
MIRT1446992	hsa-miR-4731-5p	CLIP-seq
MIRT1446993	hsa-miR-4757-5p	CLIP-seq
MIRT1446994	hsa-miR-4789-3p	CLIP-seq
MIRT1446995	hsa-miR-500a	CLIP-seq
MIRT1446996	hsa-miR-5095	CLIP-seq
MIRT1446997	hsa-miR-512-3p	CLIP-seq
MIRT1446998	hsa-miR-519d	CLIP-seq
MIRT1446999	hsa-miR-520a-3p	CLIP-seq
MIRT1447000	hsa-miR-520b	CLIP-seq
MIRT1447001	hsa-miR-520c-3p	CLIP-seq
MIRT1447002	hsa-miR-520d-3p	CLIP-seq
MIRT1447003	hsa-miR-520e	CLIP-seq
MIRT1447004	hsa-miR-520g	CLIP-seq
MIRT1447005	hsa-miR-520h	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT1447007	hsa-miR-603	CLIP-seq
MIRT1447008	hsa-miR-626	CLIP-seq
MIRT1447009	hsa-miR-802	CLIP-seq
MIRT1447010	hsa-miR-93	CLIP-seq
MIRT1446949	hsa-miR-1227	CLIP-seq
MIRT1446950	hsa-miR-134	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446960	hsa-miR-2964a-5p	CLIP-seq
MIRT1446969	hsa-miR-3118	CLIP-seq
MIRT1446970	hsa-miR-3136-5p	CLIP-seq
MIRT1446971	hsa-miR-3152-5p	CLIP-seq
MIRT1446975	hsa-miR-3611	CLIP-seq
MIRT1446983	hsa-miR-4312	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT1446986	hsa-miR-4439	CLIP-seq
MIRT1446987	hsa-miR-4513	CLIP-seq
MIRT1446989	hsa-miR-4677-3p	CLIP-seq
MIRT1446990	hsa-miR-4679	CLIP-seq
MIRT1446991	hsa-miR-4709-3p	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT1447008	hsa-miR-626	CLIP-seq
MIRT1446949	hsa-miR-1227	CLIP-seq
MIRT1446950	hsa-miR-134	CLIP-seq
MIRT2354851	hsa-miR-181a	CLIP-seq
MIRT2354852	hsa-miR-181b	CLIP-seq
MIRT2354853	hsa-miR-181c	CLIP-seq
MIRT2354854	hsa-miR-181d	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446960	hsa-miR-2964a-5p	CLIP-seq
MIRT1446969	hsa-miR-3118	CLIP-seq
MIRT1446970	hsa-miR-3136-5p	CLIP-seq
MIRT1446971	hsa-miR-3152-5p	CLIP-seq
MIRT1446975	hsa-miR-3611	CLIP-seq
MIRT2354855	hsa-miR-4262	CLIP-seq
MIRT1446983	hsa-miR-4312	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT1446986	hsa-miR-4439	CLIP-seq
MIRT1446987	hsa-miR-4513	CLIP-seq
MIRT1446989	hsa-miR-4677-3p	CLIP-seq
MIRT1446990	hsa-miR-4679	CLIP-seq
MIRT1446991	hsa-miR-4709-3p	CLIP-seq
MIRT2354856	hsa-miR-4742-3p	CLIP-seq
MIRT2354857	hsa-miR-487a	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT2354858	hsa-miR-550b	CLIP-seq
MIRT1447008	hsa-miR-626	CLIP-seq
MIRT2354859	hsa-miR-630	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT2354857	hsa-miR-487a	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT1446949	hsa-miR-1227	CLIP-seq
MIRT1446950	hsa-miR-134	CLIP-seq
MIRT1446952	hsa-miR-155	CLIP-seq
MIRT2354851	hsa-miR-181a	CLIP-seq
MIRT2354852	hsa-miR-181b	CLIP-seq
MIRT2354853	hsa-miR-181c	CLIP-seq
MIRT2354854	hsa-miR-181d	CLIP-seq
MIRT1446954	hsa-miR-194	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446959	hsa-miR-2467-3p	CLIP-seq
MIRT1446960	hsa-miR-2964a-5p	CLIP-seq
MIRT1446969	hsa-miR-3118	CLIP-seq
MIRT1446971	hsa-miR-3152-5p	CLIP-seq
MIRT1446975	hsa-miR-3611	CLIP-seq
MIRT1446978	hsa-miR-3678-3p	CLIP-seq
MIRT2354855	hsa-miR-4262	CLIP-seq
MIRT1446983	hsa-miR-4312	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT1446989	hsa-miR-4677-3p	CLIP-seq
MIRT1446990	hsa-miR-4679	CLIP-seq
MIRT1446991	hsa-miR-4709-3p	CLIP-seq
MIRT2354857	hsa-miR-487a	CLIP-seq
MIRT1446995	hsa-miR-500a	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT1447008	hsa-miR-626	CLIP-seq
MIRT1447009	hsa-miR-802	CLIP-seq
MIRT1446949	hsa-miR-1227	CLIP-seq
MIRT1446950	hsa-miR-134	CLIP-seq
MIRT1446952	hsa-miR-155	CLIP-seq
MIRT2354851	hsa-miR-181a	CLIP-seq
MIRT2354852	hsa-miR-181b	CLIP-seq
MIRT2354853	hsa-miR-181c	CLIP-seq
MIRT2354854	hsa-miR-181d	CLIP-seq
MIRT1446954	hsa-miR-194	CLIP-seq
MIRT1446957	hsa-miR-221	CLIP-seq
MIRT1446958	hsa-miR-222	CLIP-seq
MIRT1446959	hsa-miR-2467-3p	CLIP-seq
MIRT1446960	hsa-miR-2964a-5p	CLIP-seq
MIRT1446969	hsa-miR-3118	CLIP-seq
MIRT1446970	hsa-miR-3136-5p	CLIP-seq
MIRT1446971	hsa-miR-3152-5p	CLIP-seq
MIRT1446975	hsa-miR-3611	CLIP-seq
MIRT1446978	hsa-miR-3678-3p	CLIP-seq
MIRT2354855	hsa-miR-4262	CLIP-seq
MIRT1446983	hsa-miR-4312	CLIP-seq
MIRT1446984	hsa-miR-4436b-5p	CLIP-seq
MIRT1446986	hsa-miR-4439	CLIP-seq
MIRT1446987	hsa-miR-4513	CLIP-seq
MIRT1446989	hsa-miR-4677-3p	CLIP-seq
MIRT1446990	hsa-miR-4679	CLIP-seq
MIRT1446991	hsa-miR-4709-3p	CLIP-seq
MIRT2354857	hsa-miR-487a	CLIP-seq
MIRT1446995	hsa-miR-500a	CLIP-seq
MIRT1447006	hsa-miR-548v	CLIP-seq
MIRT1447008	hsa-miR-626	CLIP-seq
MIRT1447009	hsa-miR-802	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12198123, 30021884, 35271311
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	12198123
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	18331822
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IBA
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IDA	12198123
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IEA
GO:0005742	Component	Mitochondrial outer membrane translocase complex	TAS	24270810
GO:0008320	Function	Protein transmembrane transporter activity	TAS	15644312
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	TAS	15644312
GO:0031647	Process	Regulation of protein stability	IMP	24270810
GO:0045040	Process	Protein insertion into mitochondrial outer membrane	NAS	18331822
GO:0140596	Component	TOM complex	NAS	18331822
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IBA
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24270810
GO:1905091	Process	Positive regulation of type 2 mitophagy	IMP	24270810

MIM	HGNC	e!Ensembl
607980	21648	ENSG00000196683

Q9P0U1

Protein name

Mitochondrial import receptor subunit TOM7 homolog (Translocase of outer membrane 7 kDa subunit homolog)

Protein function

Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria. {ECO:0000269|PubMed:18331822, ECO:000

PDB

7CK6 , 7CP9 , 7VBY , 7VC4 , 7VD2 , 7VDD , 8XVA , 9EIH , 9EII , 9EIJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08038	Tom7	9 → 53	TOM7 family	Family

Sequence

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Pink/Parkin Mediated Mitophagy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Garg-Mishra progeroid syndrome	Likely pathogenic; Pathogenic	rs1782411099, rs778567973	RCV003403732 RCV003397172	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUDITORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Cutis Laxa Autosomal Recessive Type IIB	Associate	36282599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	36282599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	24270810, 33536081	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Associate	36282599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeroid syndrome neonatal	Associate	36282599	★★★★★ ★☆☆☆☆ Found in Text Mining only

TOMM7 (translocase of outer mitochondrial membrane 7)