Gene Gene information from NCBI Gene database.
Entrez ID 54541
Gene name DNA damage inducible transcript 4
Gene symbol DDIT4
Synonyms (NCBI Gene)
Dig2REDD-1REDD1
Chromosome 10
Chromosome location 10q22.1
miRNA miRNA information provided by mirtarbase database.
1003
miRTarBase ID miRNA Experiments Reference
MIRT003358 hsa-miR-221-3p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 20018759
MIRT003358 hsa-miR-221-3p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 20018759
MIRT005575 hsa-miR-181a-5p ImmunoblotLuciferase reporter assayqRT-PCR 21274007
MIRT022661 hsa-miR-124-3p Microarray 18668037
MIRT003358 hsa-miR-221-3p Reporter assay;Western blot;qRT-PCR;Microarray;Other 20018759
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
ATF4 Activation 19059405;19439225
VDR Unknown 21123297
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IBA
GO:0001666 Process Response to hypoxia IDA 20166753
GO:0001666 Process Response to hypoxia IEA
GO:0001764 Process Neuron migration ISS
GO:0005515 Function Protein binding IPI 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607729 24944 ENSG00000168209
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NX09
Protein name DNA damage-inducible transcript 4 protein (HIF-1 responsive protein RTP801) (Protein regulated in development and DNA damage response 1) (REDD-1)
Protein function Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1). Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and th
PDB 3LQ9 , 7MOP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07809 RTP801_C 104 223 RTP801 C-terminal region Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with lowest levels in brain, skeletal muscle and intestine. Up-regulated in substantia nigra neurons from Parkinson disease patients (at protein level). {ECO:0000269|PubMed:11884613, ECO:0000269|PubMed:12453409, ECO:
Sequence
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYS
SEQLLIEEC
Sequence length 232
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
MicroRNAs in cancer
  TP53 Regulates Metabolic Genes