Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54541
Gene name Gene Name - the full gene name approved by the HGNC.
DNA damage inducible transcript 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DDIT4
Synonyms (NCBI Gene) Gene synonyms aliases
Dig2, REDD-1, REDD1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003358 hsa-miR-221-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 20018759
MIRT003358 hsa-miR-221-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 20018759
MIRT005575 hsa-miR-181a-5p Immunoblot, Luciferase reporter assay, qRT-PCR 21274007
MIRT022661 hsa-miR-124-3p Microarray 18668037
MIRT003358 hsa-miR-221-3p Reporter assay;Western blot;qRT-PCR;Microarray;Other 20018759
Transcription factors
Transcription factor Regulation Reference
ATF4 Activation 19059405;19439225
VDR Unknown 21123297
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IBA
GO:0001666 Process Response to hypoxia IDA 20166753
GO:0001666 Process Response to hypoxia IEA
GO:0001764 Process Neuron migration ISS
GO:0005515 Function Protein binding IPI 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607729 24944 ENSG00000168209
Protein
UniProt ID Q9NX09
Protein name DNA damage-inducible transcript 4 protein (HIF-1 responsive protein RTP801) (Protein regulated in development and DNA damage response 1) (REDD-1)
Protein function Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1). Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and th
PDB 3LQ9 , 7MOP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07809 RTP801_C 104 223 RTP801 C-terminal region Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with lowest levels in brain, skeletal muscle and intestine. Up-regulated in substantia nigra neurons from Parkinson disease patients (at protein level). {ECO:0000269|PubMed:11884613, ECO:0000269|PubMed:12453409, ECO:
Sequence
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYS
SEQLLIEEC
Sequence length 232
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
MicroRNAs in cancer
  TP53 Regulates Metabolic Genes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 25337238
Adenocarcinoma of Lung Associate 30727821, 35149175, 35325730, 36400857, 37671155, 39311766
Adrenocortical Carcinoma Associate 35500219
Alzheimer Disease Associate 19210572, 37545529
Ascites Associate 25337238
Breast Neoplasms Associate 26607805, 32497068, 34990474, 36647876
Carcinogenesis Associate 31755224
Carcinoma Hepatocellular Associate 30982498, 34045534
Carcinoma Non Small Cell Lung Associate 28534368
Carcinoma Ovarian Epithelial Associate 30428884