Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5454
Gene name	POU class 3 homeobox 2
Gene symbol	POU3F2
Synonyms (NCBI Gene)	BRN2N-Oct3OCT7OTF-7OTF7POUF3brn-2oct-7
Chromosome	6
Chromosome location	6q16.1
Summary	This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is

140

Show/Hide all (140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT024206	hsa-miR-221-3p	qRT-PCR	20516212
MIRT052422	hsa-let-7a-5p	CLASH	23622248
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638417	hsa-miR-4297	HITS-CLIP	23824327
MIRT638416	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638412	hsa-miR-5096	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT442062	hsa-miR-5681a	PAR-CLIP	22291592
MIRT442060	hsa-miR-3153	PAR-CLIP	22291592
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22291592
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22291592
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22291592
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	23708386
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	23708386
MIRT442062	hsa-miR-5681a	PAR-CLIP	23708386
MIRT442060	hsa-miR-3153	PAR-CLIP	23708386
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	23708386
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	23708386
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	23708386
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT734691	hsa-miR-590-3p	qRT-PCR	31484947
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638417	hsa-miR-4297	HITS-CLIP	23824327
MIRT638416	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638412	hsa-miR-5096	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT442062	hsa-miR-5681a	PAR-CLIP	22291592
MIRT442060	hsa-miR-3153	PAR-CLIP	22291592
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22291592
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22291592
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22291592
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	23708386
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	23708386
MIRT442062	hsa-miR-5681a	PAR-CLIP	23708386
MIRT442060	hsa-miR-3153	PAR-CLIP	23708386
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	23708386
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	23708386
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	23708386
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT1250973	hsa-miR-1200	CLIP-seq
MIRT1250974	hsa-miR-129-5p	CLIP-seq
MIRT1250975	hsa-miR-1299	CLIP-seq
MIRT1250976	hsa-miR-219-2-3p	CLIP-seq
MIRT1250977	hsa-miR-3074-5p	CLIP-seq
MIRT1250978	hsa-miR-3123	CLIP-seq
MIRT1250979	hsa-miR-3126-3p	CLIP-seq
MIRT1250980	hsa-miR-3140-5p	CLIP-seq
MIRT1250981	hsa-miR-3606	CLIP-seq
MIRT1250982	hsa-miR-3667-3p	CLIP-seq
MIRT1250983	hsa-miR-3668	CLIP-seq
MIRT1250984	hsa-miR-3919	CLIP-seq
MIRT1250985	hsa-miR-3924	CLIP-seq
MIRT1250986	hsa-miR-4652-3p	CLIP-seq
MIRT1250987	hsa-miR-4756-3p	CLIP-seq
MIRT1250988	hsa-miR-4760-3p	CLIP-seq
MIRT1250989	hsa-miR-511	CLIP-seq
MIRT1250990	hsa-miR-579	CLIP-seq
MIRT1250991	hsa-miR-583	CLIP-seq
MIRT1250992	hsa-miR-664	CLIP-seq
MIRT1250993	hsa-miR-875-3p	CLIP-seq
MIRT1250994	hsa-miR-921	CLIP-seq
MIRT2074088	hsa-miR-4267	CLIP-seq
MIRT2074089	hsa-miR-4520a-5p	CLIP-seq
MIRT2074090	hsa-miR-4520b-5p	CLIP-seq
MIRT2301081	hsa-miR-125a-5p	CLIP-seq
MIRT2301082	hsa-miR-125b	CLIP-seq
MIRT2301083	hsa-miR-140-5p	CLIP-seq
MIRT2301084	hsa-miR-3180-5p	CLIP-seq
MIRT2301085	hsa-miR-331-3p	CLIP-seq
MIRT2301086	hsa-miR-3545-5p	CLIP-seq
MIRT2301087	hsa-miR-3670	CLIP-seq
MIRT2301088	hsa-miR-376c	CLIP-seq
MIRT2301089	hsa-miR-4319	CLIP-seq
MIRT2301090	hsa-miR-4460	CLIP-seq
MIRT2301091	hsa-miR-513b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SOX9	Repression	15896776

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7601453, 9482665
GO:0005515	Function	Protein binding	IPI	11029584
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0007420	Process	Brain development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15024079
GO:0008544	Process	Epidermis development	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014044	Process	Schwann cell development	IEA
GO:0021799	Process	Cerebral cortex radially oriented cell migration	IEA
GO:0021869	Process	Forebrain ventricular zone progenitor cell division	IEA
GO:0021897	Process	Forebrain astrocyte development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021979	Process	Hypothalamus cell differentiation	IEA
GO:0021985	Process	Neurohypophysis development	IEA
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IPI	11029584
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048665	Process	Neuron fate specification	IEA
GO:0048665	Process	Neuron fate specification	ISS
GO:0048666	Process	Neuron development	IEA
GO:0048666	Process	Neuron development	ISS
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0061101	Process	Neuroendocrine cell differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600494	9215	ENSG00000184486

P20265

Protein name

POU domain, class 3, transcription factor 2 (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Brn-2) (Nervous system-specific octamer-binding transcription factor N-Oct-3) (Octamer-binding protein 7) (Oct-7) (Octamer-binding transcription factor 7

Protein function

Transcription factor that plays a key role in neuronal differentiation (By similarity). Binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a non-conserved spacer region

PDB

7XRC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00157	Pou	265 → 336	Pou domain - N-terminal to homeobox domain	Domain
PF00046	Homeodomain	355 → 411	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in the neuroectodermal cell lineage.

Sequence

MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ

Sequence length

443

Interactions

View interactions

	Reactome
			EGR2 and SOX10-mediated initiation of Schwann cell myelination

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
POU3F2-associated disorder	Likely pathogenic	rs1769989432	RCV001254102

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
POU3F2-related disorder	Uncertain significance; Likely benign	rs560285896, rs1344904623, rs369383182, rs1554212728, rs371685985	RCV003402542 RCV003914718 RCV003911712 RCV003956712 RCV003964775

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute cholinergic dysautonomia	Associate	29453933
Atrial Fibrillation	Associate	32478689
Autism Spectrum Disorder	Associate	21915259, 27378147, 33539344
Bipolar Disorder	Associate	21915259, 24618891, 30545964, 30772379
Breast Neoplasms	Associate	33492284, 37596527
Central Nervous System Diseases	Associate	36791193
Diabetes Mellitus	Associate	36978091
Glioblastoma	Associate	24601786, 24726434, 26020805, 27852622, 29773872, 30497369, 34282187
Glycosuria Renal	Associate	36978091
Heart Diseases	Associate	32664164
Hyperphagia	Associate	37207645
Hypersensitivity Delayed	Associate	37207645
Hypertension	Associate	32664164
Hypoalphalipoproteinemias	Associate	16858508
Melanoma	Associate	11029584, 14708619, 23069940, 30277012, 30804224, 32169117, 34958806, 38169586
Mental Disorders	Associate	30545964
Multiple Sclerosis	Associate	31484947
Neoplasm Metastasis	Associate	34958806
Neoplasms	Associate	11029584, 30804224, 34958806, 35578189
Nevus Pigmented	Inhibit	19845757
Obesity	Associate	37207645
Schizophrenia	Associate	21915259, 30545964, 30772379
Stomach Neoplasms	Associate	35578189
Ventricular Remodeling	Associate	32664164

POU3F2 (POU class 3 homeobox 2)