Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5454
Gene name Gene Name - the full gene name approved by the HGNC.
POU class 3 homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POU3F2
Synonyms (NCBI Gene) Gene synonyms aliases
BRN2, N-Oct3, OCT7, OTF-7, OTF7, POUF3, brn-2, oct-7
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q16.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006355 hsa-miR-211-5p Luciferase reporter assay, Western blot 21435193
MIRT006355 hsa-miR-211-5p Luciferase reporter assay, Western blot 21435193
MIRT006355 hsa-miR-211-5p Luciferase reporter assay, Western blot 21435193
MIRT006355 hsa-miR-211-5p Luciferase reporter assay, Western blot 21435193
MIRT006355 hsa-miR-211-5p Luciferase reporter assay, Western blot 21435193
Transcription factors
Transcription factor Regulation Reference
SOX9 Repression 15896776
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600494 9215 ENSG00000184486
Protein
UniProt ID P20265
Protein name POU domain, class 3, transcription factor 2 (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Brn-2) (Nervous system-specific octamer-binding transcription factor N-Oct-3) (Octamer-binding protein 7) (Oct-7) (Octamer-binding transcription factor 7
Protein function Transcription factor that plays a key role in neuronal differentiation (By similarity). Binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a non-conserved spacer region
PDB 7XRC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 265 336 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 355 411 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in the neuroectodermal cell lineage.
Sequence
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEAD
SSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKR
MTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ
Sequence length 443
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    EGR2 and SOX10-mediated initiation of Schwann cell myelination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Erectile Dysfunction Erectile Dysfunction GWAS
Neuroticism Neuroticism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute cholinergic dysautonomia Associate 29453933
Atrial Fibrillation Associate 32478689
Autism Spectrum Disorder Associate 21915259, 27378147, 33539344
Bipolar Disorder Associate 21915259, 24618891, 30545964, 30772379
Breast Neoplasms Associate 33492284, 37596527
Central Nervous System Diseases Associate 36791193
Diabetes Mellitus Associate 36978091
Glioblastoma Associate 24601786, 24726434, 26020805, 27852622, 29773872, 30497369, 34282187
Glycosuria Renal Associate 36978091
Heart Diseases Associate 32664164