POU3F1 (POU class 3 homeobox 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5453
Gene name Gene Name - the full gene name approved by the HGNC.
POU class 3 homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POU3F1
Synonyms (NCBI Gene) Gene synonyms aliases
OCT6, OTF6, SCIP
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(300)
miRTarBase ID miRNA Experiments Reference
MIRT613920 hsa-miR-1247-3p HITS-CLIP 23824327
MIRT488113 hsa-miR-4532 HITS-CLIP 23824327
MIRT613919 hsa-miR-3183 HITS-CLIP 23824327
MIRT613918 hsa-miR-4723-3p HITS-CLIP 23824327
MIRT613917 hsa-miR-6769b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003700 Function DNA-binding transcription factor activity TAS 8451175, 8662541
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602479 9214 ENSG00000185668
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q03052
Protein name POU domain, class 3, transcription factor 1 (Octamer-binding protein 6) (Oct-6) (Octamer-binding transcription factor 6) (OTF-6) (POU domain transcription factor SCIP)
Protein function Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') (By similarity). Acts as a transcriptional activator when binding cooperatively with SOX4, SOX11, or SOX12 to gene promoters (By similarity). Acts as a transcriptional repress
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 250 → 321 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 340 → 396 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonal stem cells and in the developing brain.
Sequence 
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGA
GAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQG
AAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGG
GGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSS
VGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ
LSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLK
CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG
GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ
Sequence length 451
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    EGR2 and SOX10-mediated initiation of Schwann cell myelination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 23143596
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 15367334
Leukoencephalopathy Progressive Multifocal Associate 7791781
Schizophrenia Associate 16246257
Thyroid Neoplasms Associate 35619584