Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5452
Gene name Gene Name - the full gene name approved by the HGNC.
POU class 2 homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POU2F2
Synonyms (NCBI Gene) Gene synonyms aliases
OCT2, OTF2, Oct-2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5`-ATTTGCAT-3`, a common transcription factor binding site in immunoglobulin gene promoters. Several tr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000639 hsa-miR-9-5p Luciferase reporter assay 19956200
MIRT720159 hsa-miR-130b-5p HITS-CLIP 19536157
MIRT720158 hsa-miR-4753-3p HITS-CLIP 19536157
MIRT720157 hsa-miR-29b-2-5p HITS-CLIP 19536157
MIRT388051 hsa-miR-4768-5p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 9360945
RELA Unknown 9360945
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
164176 9213 ENSG00000028277
Protein
UniProt ID P09086
Protein name POU domain, class 2, transcription factor 2 (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) (Octamer-binding protein 2) (Oct-2) (Octamer-binding transcription factor 2) (OTF-2)
Protein function Transcription factor that specifically binds to the octamer motif (5'-ATTTGCAT-3') (PubMed:2904654, PubMed:7859290). Regulates IL6 expression in B cells with POU2AF1 (By similarity). Regulates transcription in a number of tissues in addition to
PDB 1HDP , 9DZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 198 269 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 298 354 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 3 is B-cell specific. Isoform 5 is expressed in B-cells and the immunoglobulin-expressing T-cell line MOLT-4, but not in the T-cell line BW5147. {ECO:0000269|PubMed:2904654, ECO:0000269|PubMed:3072196}.
Sequence
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS
HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT
ISRFEALNLSFKNMCKLKPLLEKWLNDAE
TMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK
RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKR
INPCSA
APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Sequence length 479
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Herpes simplex virus 1 infection
Lipid and atherosclerosis
  RNA polymerase II transcribes snRNA genes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer, Prostate cancer (advanced) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29127420
Anodontia Associate 11154228, 8639794
Breast Neoplasms Associate 31420918, 39948777
Burkitt Lymphoma Associate 22346751
Carcinoma Non Small Cell Lung Associate 33300085
Carcinoma Renal Cell Associate 31088315
Choriocarcinoma Associate 11113121
Colorectal Neoplasms Associate 28992563
Diabetes Mellitus Type 2 Associate 32041280
Epstein Barr Virus Infections Associate 27009953