Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5451
Gene name Gene Name - the full gene name approved by the HGNC.
POU class 2 homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POU2F1
Synonyms (NCBI Gene) Gene synonyms aliases
OCT1, OTF1, Oct1Z, oct-1B
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA bindi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021477 hsa-miR-9-5p Microarray 17612493
MIRT024501 hsa-miR-215-5p Microarray 19074876
MIRT025581 hsa-miR-34a-5p Sequencing 20371350
MIRT026960 hsa-miR-192-5p Microarray 19074876
MIRT027386 hsa-miR-101-3p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
PPARG Activation 12881480
STAT3 Unknown 23172665
USF1 Unknown 18845576
USF2 Unknown 18845576
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 25802280
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IMP 10329190, 10541551, 11380252
GO:0000979 Function RNA polymerase II core promoter sequence-specific DNA binding IMP 10541551
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
164175 9212 ENSG00000143190
Protein
UniProt ID P14859
Protein name POU domain, class 2, transcription factor 1 (NF-A1) (Octamer-binding protein 1) (Oct-1) (Octamer-binding transcription factor 1) (OTF-1)
Protein function Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactiv
PDB 1CQT , 1E3O , 1GT0 , 1HF0 , 1O4X , 1OCT , 1POG , 1POU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 283 354 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 380 436 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Isoform 2 is lymphocyte-specific.
Sequence
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE
NLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKR
INPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ
Sequence length 743
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Herpes simplex virus 1 infection
Lipid and atherosclerosis
  Interleukin-4 and Interleukin-13 signaling
RNA polymerase II transcribes snRNA genes
RNA Polymerase III Transcription Initiation From Type 3 Promoter
Estrogen-dependent gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Sickle Cell Associate 19327156
Arthritis Psoriatic Associate 37137278
Arthritis Rheumatoid Associate 9797555
Asthma Associate 21320718
beta Thalassemia Associate 19327156
Breast Neoplasms Associate 34242723, 34768935
Carcinogenesis Associate 1653419, 27658774
Carcinoma Embryonal Associate 8455626
Carcinoma Hepatocellular Associate 21985966, 28489585, 29138286, 33541355, 35318110, 35510337
Cerebral Infarction Associate 31168961