Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54498
Gene name Gene Name - the full gene name approved by the HGNC.	Spermine oxidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SMOX
Synonyms (NCBI Gene) Gene synonyms aliases	C20orf16, PAO, PAO-1, PAO1, PAOH, PAOH1, SMO
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p13
Summary Summary of gene provided in NCBI Entrez Gene.	Polyamines are ubiquitous polycationic alkylamines which include spermine, spermidine, putrescine, and agmatine. These molecules participate in a broad range of cellular functions which include cell cycle modulation, scavenging reactive oxygen species, an

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040277	hsa-miR-615-3p	CLASH	23622248
MIRT457730	hsa-miR-370-5p	PAR-CLIP	23592263
MIRT457729	hsa-miR-3677-5p	PAR-CLIP	23592263
MIRT457728	hsa-miR-3135b	PAR-CLIP	23592263
MIRT457727	hsa-miR-3689d	PAR-CLIP	23592263
MIRT457726	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT457725	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT457724	hsa-miR-760	PAR-CLIP	23592263
MIRT457722	hsa-miR-3652	PAR-CLIP	23592263
MIRT457723	hsa-miR-4430	PAR-CLIP	23592263
MIRT457721	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT457720	hsa-miR-4460	PAR-CLIP	23592263
MIRT457719	hsa-miR-8057	PAR-CLIP	23592263
MIRT457730	hsa-miR-370-5p	PAR-CLIP	23592263
MIRT457729	hsa-miR-3677-5p	PAR-CLIP	23592263
MIRT457728	hsa-miR-3135b	PAR-CLIP	23592263
MIRT457727	hsa-miR-3689d	PAR-CLIP	23592263
MIRT457726	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT457725	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT457724	hsa-miR-760	PAR-CLIP	23592263
MIRT457722	hsa-miR-3652	PAR-CLIP	23592263
MIRT457723	hsa-miR-4430	PAR-CLIP	23592263
MIRT457721	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT457720	hsa-miR-4460	PAR-CLIP	23592263
MIRT457719	hsa-miR-8057	PAR-CLIP	23592263
MIRT1373807	hsa-miR-139-5p	CLIP-seq
MIRT1373808	hsa-miR-4668-3p	CLIP-seq
MIRT1373809	hsa-miR-4797-5p	CLIP-seq
MIRT1373810	hsa-miR-500a	CLIP-seq
MIRT1373811	hsa-miR-501-5p	CLIP-seq
MIRT1373812	hsa-miR-548c-3p	CLIP-seq
MIRT1373813	hsa-miR-577	CLIP-seq
MIRT1373814	hsa-miR-338-3p	CLIP-seq
MIRT1373815	hsa-miR-4257	CLIP-seq
MIRT1373816	hsa-miR-4530	CLIP-seq
MIRT1373817	hsa-miR-4713-3p	CLIP-seq
MIRT1373818	hsa-miR-95	CLIP-seq
MIRT2440578	hsa-miR-1178	CLIP-seq
MIRT2440579	hsa-miR-1224-3p	CLIP-seq
MIRT2440580	hsa-miR-1254	CLIP-seq
MIRT2440581	hsa-miR-3116	CLIP-seq
MIRT2440582	hsa-miR-4254	CLIP-seq
MIRT1373815	hsa-miR-4257	CLIP-seq
MIRT2440583	hsa-miR-4434	CLIP-seq
MIRT2440584	hsa-miR-4485	CLIP-seq
MIRT2440585	hsa-miR-4516	CLIP-seq
MIRT2440586	hsa-miR-4531	CLIP-seq
MIRT2440587	hsa-miR-767-3p	CLIP-seq
MIRT1373818	hsa-miR-95	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006596	Process	Polyamine biosynthetic process	TAS
GO:0006598	Process	Polyamine catabolic process	IDA	12477380
GO:0016491	Function	Oxidoreductase activity	IBA	21873635
GO:0031965	Component	Nuclear membrane	IDA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0046208	Process	Spermine catabolic process	IEA
GO:0046592	Function	Polyamine oxidase activity	IBA	21873635
GO:0046592	Function	Polyamine oxidase activity	IDA	12477380
GO:0052894	Function	Norspermine:oxygen oxidoreductase activity	IEA
GO:0052895	Function	N1-acetylspermine:oxygen oxidoreductase (N1-acetylspermidine-forming) activity	IEA
GO:0052901	Function	Spermine:oxygen oxidoreductase (spermidine-forming) activity	TAS

MIM	HGNC	e!Ensembl
615854	15862	ENSG00000088826

Protein

UniProt ID

Q9NWM0

Protein name

Spermine oxidase (EC 1.5.3.16) (Polyamine oxidase 1) (PAO-1) (PAOh1)

Protein function

Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important

PDB

7OXL , 7OY0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01593	Amino_oxidase	34 → 277	Flavin containing amine oxidoreductase	Domain
PF01593	Amino_oxidase	304 → 544	Flavin containing amine oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in human tumor cell lines. Isoform 4 is only found in an embryonal kidney cell line. {ECO:0000269|PubMed:18422650}.

Sequence

MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEPRGEGDHNHDTGEGGQGGEEP
RGGRWDEDEQWSVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGT

Sequence length

555

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism beta-Alanine metabolism Metabolic pathways		PAOs oxidise polyamines to amines Interconversion of polyamines

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Panic Disorder	Panic Disorder	GWAS
Alzheimer disease	Alzheimer disease	GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	37334367
Asthma	Associate	34456632
Carcinogenesis	Associate	18302221, 18422650, 27041578, 35452470, 39305951
Carcinoma Non Small Cell Lung	Associate	18422650
Carcinoma Renal Cell	Associate	39993614
Colitis Ulcerative	Associate	20127992
Colorectal Neoplasms	Associate	27433286
DNA Virus Infections	Associate	18422650
Gastritis	Associate	27041578
Helicobacter Infections	Stimulate	39305951
Hypertensive Retinopathy	Associate	35452470
Inflammation	Associate	18422650, 20127992, 27433286, 35452470
Inflammation	Stimulate	27041578, 39305951
Mood Disorders	Associate	21152090
Myositis	Stimulate	18302221
Neoplasms	Associate	27433286, 34465810
Neoplasms	Stimulate	35452470
Neuroblastoma	Associate	26895301
Neurocognitive Disorders	Associate	26895301
Neurologic Manifestations	Associate	35452470
Prostatic Diseases	Associate	18302221
Prostatic Intraepithelial Neoplasia	Stimulate	18302221
Prostatic Neoplasms	Associate	18302221
Prostatic Neoplasms	Stimulate	35452470
Soft Tissue Injuries	Stimulate	27433286
Stomach Neoplasms	Associate	27041578, 39305951

SMOX (spermine oxidase)