KRT20 (keratin 20)

Gene

• Entrez ID: 54474
• Gene name: Keratin 20
• Gene symbol: KRT20
• Synonyms (NCBI Gene): CD20, CK-20, CK20, K20, KRT21
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1101200	hsa-miR-135a	CLIP-seq
MIRT1101201	hsa-miR-135b	CLIP-seq
MIRT1101202	hsa-miR-140-5p	CLIP-seq
MIRT1101203	hsa-miR-150	CLIP-seq
MIRT1101204	hsa-miR-299-5p	CLIP-seq
MIRT1101205	hsa-miR-3160-5p	CLIP-seq
MIRT1101206	hsa-miR-4473	CLIP-seq
MIRT1101207	hsa-miR-4796-3p	CLIP-seq
MIRT1101208	hsa-miR-512-3p	CLIP-seq
MIRT1101209	hsa-miR-520f	CLIP-seq
MIRT1101210	hsa-miR-633	CLIP-seq
MIRT2258852	hsa-miR-129-5p	CLIP-seq
MIRT2258853	hsa-miR-1301	CLIP-seq
MIRT2258854	hsa-miR-450b-5p	CLIP-seq
MIRT2258855	hsa-miR-4660	CLIP-seq
MIRT2258856	hsa-miR-4742-5p	CLIP-seq
MIRT2258857	hsa-miR-5047	CLIP-seq
MIRT2258858	hsa-miR-507	CLIP-seq
MIRT2258859	hsa-miR-557	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX1	Unknown	19188603

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002009	Process	Morphogenesis of an epithelium	IBA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	NAS	8359595
GO:0005515	Function	Protein binding	IPI	16189514, 16608857, 21516116, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	10973561
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005882	Component	Intermediate filament	IEA
GO:0005882	Component	Intermediate filament	NAS	8359595
GO:0006915	Process	Apoptotic process	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0030855	Process	Epithelial cell differentiation	IBA
GO:0045095	Component	Keratin filament	IBA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0045109	Process	Intermediate filament organization	IEA
GO:0045109	Process	Intermediate filament organization	IMP	12857878
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0050708	Process	Regulation of protein secretion	IEA

Other IDs

• MIM: 608218
• HGNC: 20412
• e!Ensembl: ENSG00000171431

Protein

• UniProt ID: P35900
• Protein name: Keratin, type I cytoskeletal 20 (Cytokeratin-20) (CK-20) (Keratin-20) (K20) (Protein IT)
• Protein function: Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine (By similarity). {ECO:0000250, ECO:0000269|PubMed:12857878, ECO:000
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00038	Filament	69 → 380	Intermediate filament protein	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in
• Sequence:

  MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
  GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY
  YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF
  DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
  EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
  QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK
  TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV
  EENI

• Sequence length: 424

Pathways

KEGG:

Estrogen signaling pathway
Staphylococcus aureus infection

Reactome:

Keratinization
Formation of the cornified envelope

<