Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54472
Gene name Gene Name - the full gene name approved by the HGNC.
Toll interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TOLLIP
Synonyms (NCBI Gene) Gene synonyms aliases
IL-1RAcPIP
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020158 hsa-miR-130b-3p Sequencing 20371350
MIRT028044 hsa-miR-93-5p Sequencing 20371350
MIRT041248 hsa-miR-193b-3p CLASH 23622248
MIRT439404 hsa-miR-205-5p HITS-CLIP 22473208
MIRT439404 hsa-miR-205-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005150 Function Interleukin-1, type I receptor binding IEA
GO:0005515 Function Protein binding IPI 11397809, 14563850, 16189514, 16412388, 16713569, 19060904, 19447967, 20936779, 21903422, 21988832, 25042851, 25416956, 25910212, 31515488, 32296183, 32814053
GO:0005576 Component Extracellular region TAS
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005737 Component Cytoplasm IC 11441107
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606277 16476 ENSG00000078902
Protein
UniProt ID Q9H0E2
Protein name Toll-interacting protein
Protein function Component of the signaling pathway of IL-1 and Toll-like receptors (PubMed:10854325, PubMed:11751856). Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex (PubMed:10854325). Inhibits IRAK1 phosphorylation
PDB 1WGL , 2N31
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 53 154 C2 domain Domain
PF02845 CUE 230 271 CUE domain Domain
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSL
SGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMG
EEP
Sequence length 274
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Toll-like receptor signaling pathway   Neutrophil degranulation
Interleukin-1 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Pulmonary fibrosis Idiopathic Pulmonary Fibrosis rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899
View all (1 more)
24429156
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Pulmonary Fibrosis Pulmonary Fibrosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Airway Obstruction Associate 35172835
Alveolitis Extrinsic Allergic Associate 38309995
Alzheimer Disease Associate 23300433
Arthritis Rheumatoid Associate 33993221
Asthma Associate 35172835, 36946148
Brain Neoplasms Associate 33420630
Breast Neoplasms Associate 17855441, 35441740
Carcinoma Renal Cell Associate 36499030
Colitis Ulcerative Inhibit 26462859
Common Variable Immunodeficiency Associate 29757592