Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54469
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND6
Synonyms (NCBI Gene) Gene synonyms aliases
AWP1, ZA20D3, ZFAND5B
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT194174 hsa-miR-181a-5p HITS-CLIP 21572407
MIRT194176 hsa-miR-181c-5p HITS-CLIP 21572407
MIRT194177 hsa-miR-181d-5p HITS-CLIP 21572407
MIRT194180 hsa-miR-4262 HITS-CLIP 21572407
MIRT194175 hsa-miR-181b-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 21810480, 25416956, 30561431, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006625 Process Protein targeting to peroxisome IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610183 30164 ENSG00000086666
Protein
UniProt ID Q6FIF0
Protein name AN1-type zinc finger protein 6 (Associated with PRK1 protein) (Zinc finger A20 domain-containing protein 3)
Protein function Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1. Required for PTS1 target sequence-depend
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01754 zf-A20 12 35 A20-like zinc finger Family
PF01428 zf-AN1 149 186 AN1-like Zinc finger Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high level in heart, skeletal muscle, liver, kidney and placenta. {ECO:0000269|PubMed:11054541}.
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDV
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYK
ADAAEKIRKENPVVVGEKIQKI
Sequence length 208
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Peroxisomal protein import
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Mellitus Type 2 Associate 25273842, 26599349, 37738238
Hypertension Associate 26599349
Inflammation Associate 36980809
Metabolic Syndrome Associate 26599349
Myopia Associate 36036911
Obesity Associate 36980809
Obesity Abdominal Associate 26599349
Prediabetic State Associate 36980809