PON3 (paraoxonase 3)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5446
Gene name Gene Name - the full gene name approved by the HGNC.
Paraoxonase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PON3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydr
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs147006695 G>A,C Conflicting-interpretations-of-pathogenicity, uncertain-significance Stop gained, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT017621 hsa-miR-335-5p Microarray 18185580
MIRT1250145 hsa-miR-518d-5p CLIP-seq
MIRT1250146 hsa-miR-519b-5p CLIP-seq
MIRT1250147 hsa-miR-519c-5p CLIP-seq
MIRT1250148 hsa-miR-520c-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0004063 Function Aryldialkylphosphatase activity IEA
GO:0004064 Function Arylesterase activity IBA 21873635
GO:0004064 Function Arylesterase activity IDA 15772423
GO:0004064 Function Arylesterase activity NAS 8661009
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602720 9206 ENSG00000105852
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q15166
Protein name Serum paraoxonase/lactonase 3 (EC 3.1.1.2) (EC 3.1.1.81) (EC 3.1.8.1)
Protein function Has low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Rapidly hydrolyzes lactones such as statin prodrugs (e.g. lovastatin). Hydrolyzes aromatic lactones and 5- or 6-member ring lactones with aliphatic substit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01731 Arylesterase 167 → 252 Arylesterase Family
Sequence 
MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELESGSEDIDILPS
GLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFI
DKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYAT
RDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVADVA
AKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPG
SEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Synthesis of 5-eicosatetraenoic acids
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Amyotrophic lateral sclerosis rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 23941283, 20582942
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Amyotrophic Lateral Sclerosis amyotrophic lateral sclerosis GenCC
Show/Hide Text Mining Associations (21)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 30097534
Alzheimer Disease Associate 20980077
Amyotrophic Lateral Sclerosis Associate 17702780
Atherosclerosis Inhibit 25723336
Autoimmune Diseases Associate 25723336
Calcium Metabolism Disorders Associate 31092010
Carcinoma Hepatocellular Associate 17702780, 27661119
Cardiomyopathy Dilated Associate 36049813
Deafness Associate 33057386
Diabetes Mellitus Inhibit 31446444