PON3 (paraoxonase 3)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5446
Gene name Paraoxonase 3
Gene symbol PON3
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q21.3
Summary This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydr
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs147006695 G>A,C Conflicting-interpretations-of-pathogenicity, uncertain-significance Stop gained, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
11
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT017621 hsa-miR-335-5p Microarray 18185580
MIRT1250145 hsa-miR-518d-5p CLIP-seq
MIRT1250146 hsa-miR-519b-5p CLIP-seq
MIRT1250147 hsa-miR-519c-5p CLIP-seq
MIRT1250148 hsa-miR-520c-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (23)
GO ID Ontology Definition Evidence Reference
GO:0003096 Process Renal sodium ion transport IEA
GO:0004063 Function Aryldialkylphosphatase activity IEA
GO:0004064 Function Arylesterase activity IBA
GO:0004064 Function Arylesterase activity IDA 15772423
GO:0004064 Function Arylesterase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602720 9206 ENSG00000105852
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15166
Protein name Serum paraoxonase/lactonase 3 (EC 3.1.1.2) (EC 3.1.1.81) (EC 3.1.8.1)
Protein function Has low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Rapidly hydrolyzes lactones such as statin prodrugs (e.g. lovastatin). Hydrolyzes aromatic lactones and 5- or 6-member ring lactones with aliphatic substit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01731 Arylesterase 167 → 252 Arylesterase Family
Sequence 
MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELESGSEDIDILPS
GLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFI
DKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYAT
RDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVADVA
AKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPG
SEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Synthesis of 5-eicosatetraenoic acids
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Adrenocortical carcinoma, hereditary Uncertain significance rs201661676 RCV005930821
Amyotrophic lateral sclerosis Conflicting classifications of pathogenicity rs147006695 RCV001095523
Familial cancer of breast Benign rs2072199 RCV005918476
Hepatocellular carcinoma Uncertain significance rs201661676 RCV005930820
Show/Hide Text Mining Associations (21)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 30097534
Alzheimer Disease Associate 20980077
Amyotrophic Lateral Sclerosis Associate 17702780
Atherosclerosis Inhibit 25723336
Autoimmune Diseases Associate 25723336
Calcium Metabolism Disorders Associate 31092010
Carcinoma Hepatocellular Associate 17702780, 27661119
Cardiomyopathy Dilated Associate 36049813
Deafness Associate 33057386
Diabetes Mellitus Inhibit 31446444