Gene Gene information from NCBI Gene database.
Entrez ID 54458
Gene name Proline rich 13
Gene symbol PRR13
Synonyms (NCBI Gene)
TXR1
Chromosome 12
Chromosome location 12q13.13
miRNA miRNA information provided by mirtarbase database.
544
miRTarBase ID miRNA Experiments Reference
MIRT051711 hsa-let-7d-5p CLASH 23622248
MIRT039592 hsa-miR-625-5p CLASH 23622248
MIRT039311 hsa-miR-425-5p CLASH 23622248
MIRT689760 hsa-miR-490-3p HITS-CLIP 23313552
MIRT689759 hsa-miR-499a-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 31515488, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610459 24528 ENSG00000205352
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZ81
Protein name Proline-rich protein 13 (Taxane-resistance protein)
Protein function Negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.
Family and domains
Sequence
MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPP
HPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKM
HKHQKHHKYHKHGKHSSSSSSSSSSDSD
Sequence length 148
Interactions View interactions