Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54458
Gene name Gene Name - the full gene name approved by the HGNC.
Proline rich 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRR13
Synonyms (NCBI Gene) Gene synonyms aliases
TXR1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051711 hsa-let-7d-5p CLASH 23622248
MIRT039592 hsa-miR-625-5p CLASH 23622248
MIRT039311 hsa-miR-425-5p CLASH 23622248
MIRT689760 hsa-miR-490-3p HITS-CLIP 23313552
MIRT689759 hsa-miR-499a-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 31515488, 32296183
GO:0005654 Component Nucleoplasm IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610459 24528 ENSG00000205352
Protein
UniProt ID Q9NZ81
Protein name Proline-rich protein 13 (Taxane-resistance protein)
Protein function Negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.
Family and domains
Sequence
MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPP
HPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKM
HKHQKHHKYHKHGKHSSSSSSSSSSDSD
Sequence length 148
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
21157449
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 27407097
Carcinoma Non Small Cell Lung Associate 21157449
Drug Related Side Effects and Adverse Reactions Associate 16847352