Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5445
Gene name Gene Name - the full gene name approved by the HGNC.	Paraoxonase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PON2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a

Show/Hide all(59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020479	hsa-miR-106b-5p	Microarray	17242205
MIRT021086	hsa-miR-186-5p	Sequencing	20371350
MIRT027891	hsa-miR-96-5p	Sequencing	20371350
MIRT031391	hsa-miR-16-5p	Proteomics	18668040
MIRT050663	hsa-miR-18a-5p	CLASH	23622248
MIRT048937	hsa-miR-92a-3p	CLASH	23622248
MIRT1250125	hsa-miR-19a	CLIP-seq
MIRT1250126	hsa-miR-19b	CLIP-seq
MIRT1250127	hsa-miR-2113	CLIP-seq
MIRT1250128	hsa-miR-2467-5p	CLIP-seq
MIRT1250129	hsa-miR-3128	CLIP-seq
MIRT1250130	hsa-miR-3188	CLIP-seq
MIRT1250131	hsa-miR-3202	CLIP-seq
MIRT1250132	hsa-miR-34a	CLIP-seq
MIRT1250133	hsa-miR-34c-5p	CLIP-seq
MIRT1250134	hsa-miR-3975	CLIP-seq
MIRT1250135	hsa-miR-4316	CLIP-seq
MIRT1250136	hsa-miR-449a	CLIP-seq
MIRT1250137	hsa-miR-449b	CLIP-seq
MIRT1250138	hsa-miR-4533	CLIP-seq
MIRT1250139	hsa-miR-4698	CLIP-seq
MIRT1250140	hsa-miR-4710	CLIP-seq
MIRT1250141	hsa-miR-4716-5p	CLIP-seq
MIRT1250142	hsa-miR-4720-5p	CLIP-seq
MIRT1250143	hsa-miR-4799-3p	CLIP-seq
MIRT1250144	hsa-miR-485-5p	CLIP-seq
MIRT1250125	hsa-miR-19a	CLIP-seq
MIRT1250126	hsa-miR-19b	CLIP-seq
MIRT1250127	hsa-miR-2113	CLIP-seq
MIRT2073851	hsa-miR-4276	CLIP-seq
MIRT1250141	hsa-miR-4716-5p	CLIP-seq
MIRT2073852	hsa-miR-1244	CLIP-seq
MIRT1250141	hsa-miR-4716-5p	CLIP-seq
MIRT2073852	hsa-miR-1244	CLIP-seq
MIRT2300690	hsa-miR-128	CLIP-seq
MIRT2300691	hsa-miR-1294	CLIP-seq
MIRT2300692	hsa-miR-199a-3p	CLIP-seq
MIRT2300693	hsa-miR-199b-3p	CLIP-seq
MIRT2300694	hsa-miR-23a	CLIP-seq
MIRT2300695	hsa-miR-23b	CLIP-seq
MIRT2300696	hsa-miR-23c	CLIP-seq
MIRT2300697	hsa-miR-27a	CLIP-seq
MIRT2300698	hsa-miR-27b	CLIP-seq
MIRT2300699	hsa-miR-30a	CLIP-seq
MIRT2300700	hsa-miR-30b	CLIP-seq
MIRT2300701	hsa-miR-30c	CLIP-seq
MIRT2300702	hsa-miR-30d	CLIP-seq
MIRT2300703	hsa-miR-30e	CLIP-seq
MIRT2300704	hsa-miR-3129-5p	CLIP-seq
MIRT2300705	hsa-miR-3145-5p	CLIP-seq
MIRT2300706	hsa-miR-3168	CLIP-seq
MIRT2300707	hsa-miR-361-5p	CLIP-seq
MIRT2300708	hsa-miR-4477b	CLIP-seq
MIRT1250139	hsa-miR-4698	CLIP-seq
MIRT2300709	hsa-miR-4764-3p	CLIP-seq
MIRT2300710	hsa-miR-4799-5p	CLIP-seq
MIRT2300711	hsa-miR-630	CLIP-seq
MIRT2300712	hsa-miR-668	CLIP-seq
MIRT2300713	hsa-miR-936	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKBIA	Activation	19401157
SREBF2	Activation	19497963

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004064	Function	Arylesterase activity	IBA
GO:0004064	Function	Arylesterase activity	IEA
GO:0004064	Function	Arylesterase activity	TAS	8661009
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IDA	15772423
GO:0009636	Process	Response to toxic substance	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	15772423
GO:0046872	Function	Metal ion binding	IEA
GO:0102007	Function	Acyl-L-homoserine-lactone lactonohydrolase activity	IDA	15772423
GO:0102007	Function	Acyl-L-homoserine-lactone lactonohydrolase activity	IEA
GO:1901335	Process	Lactone catabolic process	IDA	15772423
GO:1901335	Process	Lactone catabolic process	IEA

MIM	HGNC	e!Ensembl
602447	9205	ENSG00000105854

Protein

UniProt ID

Q15165

Protein name

Serum paraoxonase/arylesterase 2 (PON 2) (EC 3.1.1.2) (EC 3.1.1.81) (Aromatic esterase 2) (A-esterase 2) (Serum aryldialkylphosphatase 2)

Protein function

Capable of hydrolyzing lactones and a number of aromatic carboxylic acid esters. Has antioxidant activity. Is not associated with high density lipoprotein. Prevents LDL lipid peroxidation, reverses the oxidation of mildly oxidized LDL, and inhib

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01731	Arylesterase	167 → 252	Arylesterase	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest expression in liver, lung, placenta, testis and heart. {ECO:0000269|PubMed:11579088}.

Sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPN
GLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFI
DNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYAT
NDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSANGINISPDDKYIYVADIL
AHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIWVGCHPNGQKLFVYDPNNPPS
SEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRALYCEL

Sequence length

354

Interactions

View interactions

	Reactome
			Synthesis of 5-eicosatetraenoic acids

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Amyotrophic Lateral Sclerosis	amyotrophic lateral sclerosis	N/A	N/A	GenCC

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	18842138, 24088404, 34714861
Amyotrophic Lateral Sclerosis	Associate	18618303
Asthma	Associate	24895604
Atherosclerosis	Inhibit	20530481, 21368884
Atherosclerosis	Associate	21836061, 26169365, 34714861
Blood Coagulation Disorders	Associate	33259846
Carcinogenesis	Associate	21368884
Cardiovascular Diseases	Associate	16141008, 34714861, 36840500
Cerebral Infarction	Associate	36076661
Communicable Diseases	Associate	35092416
Constriction Pathologic	Associate	12454802
Coronary Artery Disease	Associate	12454802, 16141008
Coronary Disease	Associate	14636952, 29848931, 9443862
Cushing's symphalangism	Associate	12454802
Cystic Fibrosis	Associate	22860094
Dementia	Associate	24088404
Diabetes Mellitus	Associate	16164576
Diabetes Mellitus Type 2	Associate	32382056
Dyslipidemias	Associate	32698306
Hearing Loss	Associate	33057386
Hearing Loss Noise Induced	Associate	23327886
Heart Failure	Associate	36840500
Hyperglycemia	Associate	26169365
Hyperlipoproteinemia Type II	Associate	32489792
Hypertrophy	Inhibit	36840500
Immune System Diseases	Associate	21223581
Inflammation	Associate	24816800
Inflammation	Inhibit	36840500
Intestinal Diseases	Associate	31835890
Leukemia	Associate	27322774
Lupus Erythematosus Systemic	Associate	21223581
Lupus Nephritis	Associate	21223581
Lymphoma T Cell	Associate	36249275
Mitochondrial Diseases	Associate	21368884
Mouth Neoplasms	Associate	36613780, 38602182
Neoplasm Metastasis	Stimulate	38602182
Neoplasms	Associate	20530481, 27322774, 28430636, 35092416, 36235028, 36613780, 36653584, 38602182
Neoplasms	Stimulate	21368884
Neoplasms Squamous Cell	Associate	27322774
Neurodegenerative Diseases	Associate	35092416
Neuroinflammatory Diseases	Associate	35092416
Neutrophilia Hereditary	Associate	22860094
Non alcoholic Fatty Liver Disease	Associate	32698306
Obesity	Associate	19818126, 26123268
Pseudomonas Infections	Inhibit	22860094
Severe Acute Respiratory Syndrome	Associate	35092416
Squamous Cell Carcinoma of Head and Neck	Associate	38602182
Thyroid Neoplasms	Associate	33600548
Urinary Bladder Neoplasms	Associate	28430636
Wounds and Injuries	Inhibit	36840500

PON2 (paraoxonase 2)