TERF2IP (TERF2 interacting protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54386
Gene name Gene Name - the full gene name approved by the HGNC.
TERF2 interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TERF2IP
Synonyms (NCBI Gene) Gene synonyms aliases
DRIP5, RAP1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22. [provided by RefSeq, Apr 2010]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(648)
miRTarBase ID miRNA Experiments Reference
MIRT016173 hsa-miR-590-3p Sequencing 20371350
MIRT028687 hsa-miR-27a-3p Sequencing 20371350
MIRT031567 hsa-miR-16-5p Sequencing 20371350
MIRT052183 hsa-let-7b-5p CLASH 23622248
MIRT048531 hsa-miR-100-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(54)
GO ID Ontology Definition Evidence Reference
GO:0000228 Component Nuclear chromosome TAS 10850490
GO:0000723 Process Telomere maintenance IDA 14565979
GO:0000723 Process Telomere maintenance IEA
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 12768206, 14565979, 15109494, 21076401, 23685356, 24270157
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
605061 19246 ENSG00000166848
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Q9NYB0
Protein name Telomeric repeat-binding factor 2-interacting protein 1 (TERF2-interacting telomeric protein 1) (TRF2-interacting telomeric protein 1) (Dopamine receptor-interacting protein 5) (Repressor/activator protein 1 homolog) (RAP1 homolog) (hRap1)
Protein function Acts both as a regulator of telomere function and as a transcription regulator. Involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin com
PDB 1FEX , 3K6G , 4RQI , 7OZ0 , 8RD4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16589 BRCT_2 17 → 100 BRCT domain, a BRCA1 C-terminus domain Family
PF08914 Myb_DNA-bind_2 132 → 196 Rap1 Myb domain Domain
PF11626 Rap1_C 321 → 398 TRF2-interacting telomeric protein/Rap1 - C terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed.
Sequence 
MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPG
AVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAE
GAAEPEPQRHAGRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSL
KDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVK
EEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE
EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYP
IWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK
Sequence length 399
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Packaging Of Telomere Ends
Telomere Extension By Telomerase
DNA Damage/Telomere Stress Induced Senescence
<