Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54332
Gene name Gene Name - the full gene name approved by the HGNC.
Ganglioside induced differentiation associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GDAP1
Synonyms (NCBI Gene) Gene synonyms aliases
CMT4, CMT4A, CMTRIA
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28937906 C>T Pathogenic Intron variant, coding sequence variant, genic downstream transcript variant, missense variant
rs104894075 C>G Pathogenic Coding sequence variant, stop gained, genic downstream transcript variant, downstream transcript variant
rs104894076 G>A,T Pathogenic Coding sequence variant, intron variant, missense variant
rs104894077 C>T Conflicting-interpretations-of-pathogenicity, pathogenic Coding sequence variant, stop gained
rs104894078 C>G,T Pathogenic, uncertain-significance Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005747 hsa-miR-203a-3p Immunofluorescence, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR 20827281
MIRT005751 hsa-miR-26a-5p Immunofluorescence, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 20827281
MIRT005752 hsa-miR-200a-3p Immunofluorescence, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 20827281
MIRT020027 hsa-miR-375 Microarray 20215506
MIRT030243 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Transcription factor Regulation Reference
YY1 Activation 19720140
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000266 Process Mitochondrial fission IBA
GO:0000266 Process Mitochondrial fission IDA 15772096
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005634 Component Nucleus HDA 21630459
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606598 15968 ENSG00000104381
Protein
UniProt ID Q8TB36
Protein name Ganglioside-induced differentiation-associated protein 1 (GDAP1)
Protein function Regulates the mitochondrial network by promoting mitochondrial fission.
PDB 7AIA , 7ALM , 7B2G , 7Q6J , 7Q6K , 7YWD , 8A4J , 8A4K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13417 GST_N_3 28 105 Glutathione S-transferase, N-terminal domain Domain
PF13410 GST_C_2 163 282 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in whole brain and spinal cord. Predominant expression in central tissues of the nervous system not only in neurons but also in Schwann cells. {ECO:0000269|PubMed:11743580, ECO:0000269|PubMed:16172208}.
Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL
SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDER
TPRLMPDKESMYYPR
VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD
LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC
GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYER
VLKRKTFNKVLGHVNNIL
ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Sequence length 358
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Class I peroxisomal membrane protein import
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease, charcot-marie-tooth disease type 4a, charcot-marie-tooth disease type 4 rs1586803273, rs121908114, rs397515442, rs1586807387, rs936681187, rs1221804567, rs770501034, rs1476856429, rs1060500978, rs556827873, rs104894078, rs778547659, rs1443963090, rs281865060, rs150989205
View all (28 more)
N/A
Charcot-Marie-Tooth disease Charcot-Marie-Tooth disease axonal type 2K, Charcot-Marie-Tooth disease recessive intermediate A, Charcot-Marie-Tooth disease, axonal, with vocal cord paresis, autosomal recessive rs1060500979, rs104894078, rs397515442, rs1586807387, rs1060500978, rs281865060, rs104894079, rs778547659, rs1443963090, rs745663149, rs104894075, rs886041386, rs397515432, rs1370011538, rs756461496
View all (13 more)
N/A
Peripheral Neuropathy peripheral neuropathy rs765346218, rs538412810 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Endometriosis Endometriosis N/A N/A GWAS
Sarcoidosis Sarcoidosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Androgen Insensitivity Syndrome Associate 34470922
Ataxia Associate 18504680
Basal Ganglia Diseases Associate 15377708, 22200116
Charcot Marie Tooth Disease Associate 15377708, 18421898, 18504680, 21890626, 22200116, 24078732, 25231362, 26362287, 26556829, 26848201, 28220846, 28379183, 28395795, 28751717, 30257968
View all (19 more)
Charcot Marie Tooth disease Type 2B Associate 28751717, 33136338, 34470922
Charcot Marie Tooth disease Type 2E Associate 34470922
Charcot Marie Tooth disease Type 2K Associate 28395795, 35509130, 37058526
Charcot Marie Tooth disease Type 4A Associate 15377708, 21890626, 26848201, 33653295, 34470922, 35509130, 36140714, 37058526
Charcot Marie Tooth disease Type 4E Associate 15377708
Demyelinating Diseases Associate 18504680, 22200116, 36912213, 37058526