Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54210
Gene name	Triggering receptor expressed on myeloid cells 1
Gene symbol	TREM1
Synonyms (NCBI Gene)	CD354TREM-1
Chromosome	6
Chromosome location	6p21.1
Summary	This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-infl

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650352	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT650351	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT650350	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT650349	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT650348	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT650347	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT650346	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT650345	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT650344	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650343	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650342	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT650341	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT650340	hsa-miR-421	HITS-CLIP	23824327
MIRT650339	hsa-miR-4314	HITS-CLIP	23824327
MIRT650338	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT739223	hsa-miR-3673	HITS-CLIP	33718276
MIRT739224	hsa-miR-1	HITS-CLIP	33718276
MIRT739230	hsa-miR-4430	HITS-CLIP	33718276
MIRT650352	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT650351	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT650350	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT650349	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT650348	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT650347	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT650346	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT650345	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT650344	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650343	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650342	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT650341	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT650340	hsa-miR-421	HITS-CLIP	23824327
MIRT650339	hsa-miR-4314	HITS-CLIP	23824327
MIRT650338	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT756267	hsa-miR-150-5p	Luciferase reporter assayWestern blottingqRT-PCR	37326693
MIRT739221	hsa-miR-1252	CLIP-seq
MIRT1452400	hsa-miR-1253	CLIP-seq
MIRT739228	hsa-miR-138	CLIP-seq
MIRT739225	hsa-miR-206	CLIP-seq
MIRT1452401	hsa-miR-3120-5p	CLIP-seq
MIRT1452402	hsa-miR-3160-3p	CLIP-seq
MIRT739226	hsa-miR-3165	CLIP-seq
MIRT739231	hsa-miR-3652	CLIP-seq
MIRT1452403	hsa-miR-3921	CLIP-seq
MIRT1452404	hsa-miR-4251	CLIP-seq
MIRT1452405	hsa-miR-4325	CLIP-seq
MIRT1452406	hsa-miR-4329	CLIP-seq
MIRT739227	hsa-miR-4456	CLIP-seq
MIRT1452407	hsa-miR-4487	CLIP-seq
MIRT739229	hsa-miR-4505	CLIP-seq
MIRT1452408	hsa-miR-4653-5p	CLIP-seq
MIRT1452409	hsa-miR-4742-3p	CLIP-seq
MIRT1452410	hsa-miR-4768-5p	CLIP-seq
MIRT1452411	hsa-miR-558	CLIP-seq
MIRT739222	hsa-miR-613	CLIP-seq
MIRT1452412	hsa-miR-626	CLIP-seq
MIRT739221	hsa-miR-1252	CLIP-seq
MIRT739228	hsa-miR-138	CLIP-seq
MIRT739225	hsa-miR-206	CLIP-seq
MIRT739226	hsa-miR-3165	CLIP-seq
MIRT739231	hsa-miR-3652	CLIP-seq
MIRT739227	hsa-miR-4456	CLIP-seq
MIRT739229	hsa-miR-4505	CLIP-seq
MIRT739222	hsa-miR-613	CLIP-seq
MIRT2135446	hsa-miR-1237	CLIP-seq
MIRT2135447	hsa-miR-1248	CLIP-seq
MIRT2135448	hsa-miR-1260	CLIP-seq
MIRT2135449	hsa-miR-1260b	CLIP-seq
MIRT2135450	hsa-miR-1276	CLIP-seq
MIRT2135451	hsa-miR-188-3p	CLIP-seq
MIRT2135452	hsa-miR-3138	CLIP-seq
MIRT2135453	hsa-miR-3156-3p	CLIP-seq
MIRT2135454	hsa-miR-3160-5p	CLIP-seq
MIRT2135455	hsa-miR-331-3p	CLIP-seq
MIRT2135456	hsa-miR-3607-3p	CLIP-seq
MIRT2135457	hsa-miR-3690	CLIP-seq
MIRT2135458	hsa-miR-4267	CLIP-seq
MIRT2135459	hsa-miR-4301	CLIP-seq
MIRT2135460	hsa-miR-4308	CLIP-seq
MIRT2135461	hsa-miR-4311	CLIP-seq
MIRT2135462	hsa-miR-4638-3p	CLIP-seq
MIRT2135463	hsa-miR-4693-3p	CLIP-seq
MIRT2135464	hsa-miR-4778-3p	CLIP-seq
MIRT2135465	hsa-miR-520f	CLIP-seq
MIRT2135466	hsa-miR-583	CLIP-seq
MIRT2135446	hsa-miR-1237	CLIP-seq
MIRT2135447	hsa-miR-1248	CLIP-seq
MIRT2356588	hsa-miR-2110	CLIP-seq
MIRT2356589	hsa-miR-3150a-3p	CLIP-seq
MIRT2135455	hsa-miR-331-3p	CLIP-seq
MIRT2135457	hsa-miR-3690	CLIP-seq
MIRT2356590	hsa-miR-4271	CLIP-seq
MIRT2135460	hsa-miR-4308	CLIP-seq
MIRT2135462	hsa-miR-4638-3p	CLIP-seq
MIRT2356591	hsa-miR-4725-3p	CLIP-seq
MIRT2135464	hsa-miR-4778-3p	CLIP-seq
MIRT2396329	hsa-miR-4685-5p	CLIP-seq
MIRT2462290	hsa-miR-1323	CLIP-seq
MIRT2462291	hsa-miR-4434	CLIP-seq
MIRT2462292	hsa-miR-4468	CLIP-seq
MIRT2462293	hsa-miR-4516	CLIP-seq
MIRT2462294	hsa-miR-4722-5p	CLIP-seq
MIRT2462295	hsa-miR-4768-3p	CLIP-seq
MIRT2462296	hsa-miR-548a-3p	CLIP-seq
MIRT2462297	hsa-miR-548e	CLIP-seq
MIRT2462298	hsa-miR-548f	CLIP-seq
MIRT2462299	hsa-miR-548o	CLIP-seq
MIRT1452401	hsa-miR-3120-5p	CLIP-seq
MIRT1452402	hsa-miR-3160-3p	CLIP-seq
MIRT1452407	hsa-miR-4487	CLIP-seq
MIRT1452409	hsa-miR-4742-3p	CLIP-seq
MIRT1452411	hsa-miR-558	CLIP-seq
MIRT1452412	hsa-miR-626	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	17098818
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	26561551
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006959	Process	Humoral immune response	TAS	10799849
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	17098818
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0035556	Process	Intracellular signal transduction	TAS	10799849
GO:0038023	Function	Signaling receptor activity	TAS	10799849
GO:0045087	Process	Innate immune response	IEA
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IBA
GO:0097110	Function	Scaffold protein binding	IPI	11602640
GO:0140319	Function	Receptor decoy activity	IDA	26561551

MIM	HGNC	e!Ensembl
605085	17760	ENSG00000124731

Q9NP99

Protein name

Triggering receptor expressed on myeloid cells 1 (TREM-1) (Triggering receptor expressed on monocytes 1) (CD antigen CD354)

Protein function

[Isoform 1]: Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed:10799849, PubMed:21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimeriz

PDB

1Q8M , 1SMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	25 → 134	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Mostly expressed by immune cells of the myeloid lineage, such as monocytes, macrophages, neutrophils and dendritic cells (PubMed:10799849). Expression is associated with a mature stage of myeloid development (PubMed:11922939). Highly e

Sequence

MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD
GEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK
EPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKST
ADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP

Sequence length

234

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Cell surface interactions at the vascular wall DAP12 interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs2532514931	RCV004558022

Show/Hide Text Mining Associations (127)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	25545807
Acute Kidney Injury	Associate	22136371
Acute Kidney Injury	Stimulate	33390769
Acute Lung Injury	Associate	37700323
Acute On Chronic Liver Failure	Stimulate	35502507
Adenocarcinoma of Lung	Associate	31854219
Aggressive Periodontitis	Stimulate	24924298
Alveolitis Extrinsic Allergic	Inhibit	32508528
Alzheimer Disease	Associate	25545807, 26414614, 26625115, 36815315, 40613333
Amyloidosis	Associate	31474164
Anaphylaxis	Associate	30189430
Aortic Valve Stenosis	Associate	36199424
Arthritis	Associate	27792788
Arthritis Juvenile	Associate	21148811
Arthritis Rheumatoid	Associate	25642940, 31287012, 35777820
Asthma	Associate	27494826, 29486764, 36197221
Atherosclerosis	Associate	22642593, 28771614, 29568119, 36944850
Bacterial Infections	Associate	22996209, 24465168
Breast Neoplasms	Associate	22939885
Bronchiolitis Viral	Associate	30562046
Carcinogenesis	Associate	32684831
Carcinoma Hepatocellular	Associate	22417086, 33204302, 38350444
Carcinoma Non Small Cell Lung	Stimulate	24842612
Carcinoma Renal Cell	Associate	37217993
Cardiovascular Diseases	Associate	28771614
Carotid Stenosis	Associate	27017522, 27148736
CD59 Deficiency	Associate	36944850
Central Nervous System Cysts	Associate	27409178
Central Nervous System Diseases	Associate	36068612
Cerebral Hemorrhage	Associate	33206327
Chronic Kidney Disease Mineral and Bone Disorder	Inhibit	34176389
Cognition Disorders	Associate	25545807, 36815315
Colitis Ulcerative	Associate	30685385, 35876170
Colorectal Neoplasms	Stimulate	25049118
Colorectal Neoplasms	Associate	30918427
COVID 19	Associate	37848000
Craniopharyngioma	Associate	27409178
Crohn Disease	Associate	30685385, 33537747, 33790898
Cystic Fibrosis	Inhibit	18628981
Cystic Fibrosis	Associate	31118097
Dementia	Associate	40613333
Diabetes Mellitus	Stimulate	28454543
Diabetes Mellitus	Inhibit	35856334
Diabetes Mellitus Type 2	Associate	37047308
Diabetic Foot	Associate	35856334
Endometritis	Associate	35100093
Enterocolitis Necrotizing	Associate	34269788
Epilepsy Post Traumatic	Associate	37129904
Familial Mediterranean Fever	Associate	31474164
Fibrosis	Associate	34176389, 37002627
Frailty	Stimulate	37697678
Frontotemporal Dementia	Associate	40613333
Gastritis	Stimulate	18321350
Glioblastoma	Associate	19536297
Glioma	Associate	32684831
Glioma	Stimulate	38050264
Glucosephosphate Dehydrogenase Deficiency	Associate	37730550
Granulomatosis with Polyangiitis	Associate	25939343
Heart Failure	Associate	32154187
Helicobacter Infections	Associate	18321350
HELLP Syndrome	Associate	20541258
Hepatitis C	Stimulate	31260499
Heredodegenerative Disorders Nervous System	Associate	36068612
HIV Infections	Stimulate	31260499
HIV Infections	Associate	31719184, 37326481
Hypoxia	Associate	19536297, 30518680
Hypoxia	Stimulate	21148811
Hypoxia Brain	Associate	21148811
Infections	Associate	15332392, 20920231, 21244784, 24924298
Infections	Stimulate	22136371
Inflammation	Associate	15332392, 17097866, 18628981, 19442309, 19519945, 19900269, 23012315, 24757147, 27148736, 27448788, 27792788, 28111922, 28454543, 28771614, 29486764 View all (14 more)
Inflammation	Stimulate	18321350, 22136371, 23407402, 35100093
Inflammatory Bowel Diseases	Associate	29568119, 30685385, 33537747, 33790898
Insulin Resistance	Associate	28111922
Insulin Resistance	Stimulate	28454543
Invasive Pulmonary Aspergillosis	Inhibit	24712925
Kidney Diseases	Associate	34176389
Leukemia Lymphocytic Chronic B Cell	Associate	21134984
Lewy Body Disease	Associate	40613333
Lung Diseases	Associate	20920231
Lung Diseases Interstitial	Associate	15332392
Lung Neoplasms	Stimulate	24842612
Lung Neoplasms	Associate	31854219
Lymphohistiocytosis Hemophagocytic	Associate	21325597
Melanoma	Associate	26184544
Microcephaly	Associate	36859461
Multiple Organ Failure	Associate	22564837
Mycoses	Associate	33390769
Myocardial Infarction	Associate	29568119, 34534607, 37730550
Myocardial Ischemia	Associate	34534607
Myositis	Associate	37147138
Neoplasms	Associate	22417086, 27544999, 33769181, 34122331
Neoplasms	Stimulate	24842612, 37217993
Non alcoholic Fatty Liver Disease	Stimulate	38390691
Obesity	Associate	28111922, 28454543
Pancreatitis	Associate	15309732, 19442309
Periodontal Diseases	Associate	24924298
Periodontitis	Associate	27448788
Plaque Amyloid	Associate	25545807
Plaque Atherosclerotic	Associate	28771614
Plasma Cell Granuloma Pulmonary	Associate	15332392
Pleural Effusion	Associate	17097866
Pneumonia	Associate	14749453, 22996209
Pneumonia	Stimulate	15332392, 24465168
Pneumonia Ventilator Associated	Stimulate	25289689
Polymyositis	Stimulate	37147138
Polyps	Associate	34060497
Pre Eclampsia	Associate	20541258
Prostatic Neoplasms	Associate	32908142
Psoriasis	Associate	23407402
Pulmonary Disease Chronic Obstructive	Associate	29017955, 36655999
Pulmonary Fibrosis	Associate	37002627
Renal Insufficiency Chronic	Associate	34176389
Respiratory Tract Infections	Associate	15332392
Sarcoidosis	Inhibit	32508528
Sarcoidosis Pulmonary	Associate	26166951
Sarcoidosis Pulmonary	Stimulate	32508528
Schizophrenia	Associate	24564241
Sepsis	Associate	22136371, 33390769
Sepsis	Stimulate	35502507
Shock Septic	Associate	22564837, 24465168, 29568119
Squamous Cell Carcinoma of Head and Neck	Associate	33769181
Stomach Neoplasms	Associate	34868341
Tachycardia Sinoatrial Nodal Reentry	Stimulate	33390769
Thyroid Cancer Papillary	Associate	34122331, 38197217
Thyroid Neoplasms	Associate	34122331
Zika Virus Infection	Associate	36859461

TREM1 (triggering receptor expressed on myeloid cells 1)