TREM2 (triggering receptor expressed on myeloid cells 2)

Gene

• Entrez ID: 54209
• Gene name: Triggering receptor expressed on myeloid cells 2
• Gene symbol: TREM2
• Synonyms (NCBI Gene): AD17, PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1452413	hsa-miR-1290	CLIP-seq
MIRT1452414	hsa-miR-3167	CLIP-seq
MIRT1452415	hsa-miR-595	CLIP-seq
MIRT1452416	hsa-miR-876-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001540	Function	Amyloid-beta binding	IPI	29518356
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	ISS	29518356
GO:0001786	Function	Phosphatidylserine binding	IDA	31101881, 31902528
GO:0002116	Component	Semaphorin receptor complex	ISS
GO:0002282	Process	Microglial cell activation involved in immune response	IEA
GO:0002282	Process	Microglial cell activation involved in immune response	ISS
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA
GO:0002588	Process	Positive regulation of antigen processing and presentation of peptide antigen via MHC class II	IDA	11602640
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	ISS
GO:0002931	Process	Response to ischemia	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	29518356, 30333625
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11602640, 28490631, 29611543, 30341064
GO:0005543	Function	Phospholipid binding	IDA	27995897
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24078628, 27477018
GO:0005886	Component	Plasma membrane	IDA	27995897
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	24990881, 27589997, 28855300, 28855301
GO:0005886	Component	Plasma membrane	TAS
GO:0006909	Process	Phagocytosis	IEA
GO:0006910	Process	Phagocytosis, recognition	IMP	32514138
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	TAS
GO:0007165	Process	Signal transduction	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007613	Process	Memory	IDA	31462511
GO:0007613	Process	Memory	IMP	29518357
GO:0008013	Function	Beta-catenin binding	IPI	30683932
GO:0008035	Function	High-density lipoprotein particle binding	IDA	27477018
GO:0008289	Function	Lipid binding	IEA
GO:0008289	Function	Lipid binding	TAS	29518356
GO:0008429	Function	Phosphatidylethanolamine binding	IDA	31101881
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS	29518356
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	32514138
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010875	Process	Positive regulation of cholesterol efflux	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	ISS
GO:0010887	Process	Negative regulation of cholesterol storage	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	ISS
GO:0010891	Process	Negative regulation of triglyceride storage	IEA
GO:0010891	Process	Negative regulation of triglyceride storage	ISS
GO:0010983	Process	Positive regulation of high-density lipoprotein particle clearance	IEA
GO:0010983	Process	Positive regulation of high-density lipoprotein particle clearance	ISS
GO:0016020	Component	Membrane	IDA	11602640
GO:0016020	Component	Membrane	IEA
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0019209	Function	Kinase activator activity	IMP	31902528
GO:0019216	Process	Regulation of lipid metabolic process	IMP	32514138
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	27477018
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030316	Process	Osteoclast differentiation	IMP	21841309
GO:0030316	Process	Osteoclast differentiation	IMP	12925681
GO:0032006	Process	Regulation of TOR signaling	IEA
GO:0032006	Process	Regulation of TOR signaling	ISS
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	ISS
GO:0032497	Process	Detection of lipopolysaccharide	IEA
GO:0032499	Process	Detection of peptidoglycan	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032675	Process	Regulation of interleukin-6 production	ISS	29518356
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	IEA
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	ISS
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	ISS
GO:0034151	Process	Regulation of toll-like receptor 6 signaling pathway	IEA
GO:0034151	Process	Regulation of toll-like receptor 6 signaling pathway	ISS
GO:0034185	Function	Apolipoprotein binding	IPI	27477018
GO:0034186	Function	Apolipoprotein A-I binding	IPI	27477018
GO:0034189	Function	Very-low-density lipoprotein particle binding	IDA	27477018
GO:0034241	Process	Positive regulation of macrophage fusion	IEA
GO:0034241	Process	Positive regulation of macrophage fusion	ISS
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IEA
GO:0034351	Process	Negative regulation of glial cell apoptotic process	ISS
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	IMP	29752066
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	IMP	32514138
GO:0038023	Function	Signaling receptor activity	ISS	29518356
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IMP	33097708
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0043268	Process	Positive regulation of potassium ion transport	ISS	29518356
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	ISS
GO:0044853	Component	Plasma membrane raft	IDA	31413141
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045088	Process	Regulation of innate immune response	IBA
GO:0045088	Process	Regulation of innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	ISS
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045728	Process	Respiratory burst after phagocytosis	IEA
GO:0045728	Process	Respiratory burst after phagocytosis	ISS
GO:0045960	Process	Positive regulation of complement activation, classical pathway	IEA
GO:0045960	Process	Positive regulation of complement activation, classical pathway	ISS
GO:0048143	Process	Astrocyte activation	IEA
GO:0048143	Process	Astrocyte activation	ISS
GO:0048468	Process	Cell development	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048678	Process	Response to axon injury	IMP	31235932, 32514138
GO:0048678	Process	Response to axon injury	ISS
GO:0050714	Process	Positive regulation of protein secretion	IMP	27044754
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IMP	29518357
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IBA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	11602640
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050866	Process	Negative regulation of cell activation	IEA
GO:0050866	Process	Negative regulation of cell activation	ISS
GO:0050921	Process	Positive regulation of chemotaxis	IEA
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	30683932
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0060075	Process	Regulation of resting membrane potential	IEA
GO:0060075	Process	Regulation of resting membrane potential	ISS	29518356
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IBA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IMP	32514138
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IMP	28855300, 33097708
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	ISS
GO:0061518	Process	Microglial cell proliferation	IEA
GO:0061518	Process	Microglial cell proliferation	ISS
GO:0061889	Process	Negative regulation of astrocyte activation	IEA
GO:0061889	Process	Negative regulation of astrocyte activation	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IEA
GO:0070269	Process	Pyroptotic inflammatory response	ISS
GO:0070345	Process	Negative regulation of fat cell proliferation	IEA
GO:0070345	Process	Negative regulation of fat cell proliferation	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	11602640
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	27995897
GO:0070392	Process	Detection of lipoteichoic acid	IEA
GO:0070891	Function	Lipoteichoic acid binding	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071224	Process	Cellular response to peptidoglycan	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071396	Process	Cellular response to lipid	IEA
GO:0071396	Process	Cellular response to lipid	IMP	32514138
GO:0071402	Process	Cellular response to lipoprotein particle stimulus	IDA	27477018
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071640	Process	Regulation of macrophage inflammatory protein 1 alpha production	IEA
GO:0071640	Process	Regulation of macrophage inflammatory protein 1 alpha production	ISS	29518356
GO:0071813	Function	Lipoprotein particle binding	IDA	27477018
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0097028	Process	Dendritic cell differentiation	IDA	11602640
GO:0097062	Process	Dendritic spine maintenance	IEA
GO:0097062	Process	Dendritic spine maintenance	ISS
GO:0097110	Function	Scaffold protein binding	IPI	11602640
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0097242	Process	Amyloid-beta clearance	IEA
GO:0097367	Function	Carbohydrate derivative binding	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098657	Process	Import into cell	ISS
GO:0110089	Process	Regulation of hippocampal neuron apoptotic process	IEA
GO:0110089	Process	Regulation of hippocampal neuron apoptotic process	ISS
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IBA
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IEA
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IGI	29518356
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	ISS
GO:0120146	Function	Sulfatide binding	IDA	31902528
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IDA	31902528
GO:0150062	Process	Complement-mediated synapse pruning	IEA
GO:0150062	Process	Complement-mediated synapse pruning	ISS
GO:0150076	Process	Neuroinflammatory response	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	IMP	32514138
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IEA
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IMP	33097708
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	ISS
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900223	Process	Positive regulation of amyloid-beta clearance	IEA
GO:1900223	Process	Positive regulation of amyloid-beta clearance	IMP	31235932
GO:1900223	Process	Positive regulation of amyloid-beta clearance	ISS
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IMP	32514138
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901076	Process	Positive regulation of engulfment of apoptotic cell	IMP	24990881
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	ISS	29518356
GO:1902227	Process	Negative regulation of macrophage colony-stimulating factor signaling pathway	IMP	33097708
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	32514138
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	31902528
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS	29518356
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	11602640
GO:1903082	Process	Positive regulation of C-C chemokine receptor CCR7 signaling pathway	IDA	11602640
GO:1903376	Process	Regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903376	Process	Regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	ISS
GO:1903753	Process	Negative regulation of p38MAPK cascade	IEA
GO:1903753	Process	Negative regulation of p38MAPK cascade	ISS
GO:1903980	Process	Positive regulation of microglial cell activation	IBA
GO:1903980	Process	Positive regulation of microglial cell activation	IEA
GO:1903980	Process	Positive regulation of microglial cell activation	IMP	24990881
GO:1903980	Process	Positive regulation of microglial cell activation	ISS
GO:1904093	Process	Negative regulation of autophagic cell death	IEA
GO:1904093	Process	Negative regulation of autophagic cell death	ISS
GO:1904141	Process	Positive regulation of microglial cell migration	IEA
GO:1904141	Process	Positive regulation of microglial cell migration	IMP	33097708
GO:1904141	Process	Positive regulation of microglial cell migration	ISS	29518356
GO:1904646	Process	Cellular response to amyloid-beta	IDA	23459077, 29518356
GO:1904646	Process	Cellular response to amyloid-beta	IDA	29518356
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904646	Process	Cellular response to amyloid-beta	ISS	29518356
GO:1904951	Process	Positive regulation of establishment of protein localization	IEA
GO:1904951	Process	Positive regulation of establishment of protein localization	ISS
GO:1905291	Process	Positive regulation of CAMKK-AMPK signaling cascade	IEA
GO:1905291	Process	Positive regulation of CAMKK-AMPK signaling cascade	ISS
GO:1905581	Process	Positive regulation of low-density lipoprotein particle clearance	IEA
GO:1905581	Process	Positive regulation of low-density lipoprotein particle clearance	ISS
GO:1905805	Process	Excitatory synapse pruning	IEA
GO:1905805	Process	Excitatory synapse pruning	ISS
GO:1905808	Process	Positive regulation of synapse pruning	IMP	33097708
GO:1905907	Process	Negative regulation of amyloid fibril formation	IEA
GO:1905907	Process	Negative regulation of amyloid fibril formation	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	ISS	29518356
GO:2000350	Process	Positive regulation of CD40 signaling pathway	IDA	11602640
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	ISS

Other IDs

• MIM: 605086
• HGNC: 17761
• e!Ensembl: ENSG00000095970

Protein

• UniProt ID: Q9NZC2
• Protein name: Triggering receptor expressed on myeloid cells 2 (TREM-2) (Triggering receptor expressed on monocytes 2)
• Protein function: Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP,
• PDB: 5ELI, 5UD7, 5UD8, 6B8O, 6XDS, 6Y6C, 6YMQ, 6YYE, 6Z0G, 6Z0H, 6Z0I, 8T51, 8T59
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	19 → 129	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, specifically in microglia and in the fusiform gyrus (at protein level) (PubMed:27477018, PubMed:28802038, PubMed:28855300, PubMed:29752066). Expressed on macrophages and dendritic cells but not on granulocytes o
• Sequence:

  MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
  QRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT
  LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
  CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

• Sequence length: 230

Pathways

KEGG:

Osteoclast differentiation

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 interactions
DAP12 signaling
Other semaphorin interactions

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Frontotemporal dementia	Pathogenic	rs1765488318	RCV001810084
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy 1	Likely pathogenic; Pathogenic	rs201258663, rs797044603, rs104893998, rs121908402, rs104894002, rs386834140, rs386834141, rs386834142, rs386834143, rs386834144	RCV000192213 RCV000192212 RCV000005523 RCV000005528 RCV000005529 RCV000050134 RCV000050135 RCV000050136 RCV000050137 RCV000050138
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy 2	Likely pathogenic; Pathogenic	rs201258663, rs104893998, rs104894001, rs121908402, rs104894002, rs766712618, rs386834143, rs386834144	RCV004699120 RCV000721925 RCV000005527 RCV000721926 RCV000721927 RCV003334443 RCV000993682 RCV001810417
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephaly	Pathogenic	rs104894002	RCV005089179
TREM2-related disorder	Likely pathogenic; Pathogenic	rs121908402	RCV003398447

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Colorectal cancer	Conflicting classifications of pathogenicity	rs201258314	RCV005924088
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity	rs2234252	RCV005924038

Associations from Text Mining
Disease Name	Relationship Type	References
AA amyloidosis	Associate	26414614, 32840654, 32894242, 33198789, 37990275
Acne Vulgaris	Associate	35867799
AIDS Associated Nephropathy	Associate	30152135
Alveolitis Extrinsic Allergic	Stimulate	32508528
Alzheimer Disease	Associate	23150908, 23391427, 23582655, 23800361, 23855982, 23855984, 24041969, 24139279, 24378087, 24439484, 24508568, 24663666, 24899047, 25027412, 25114068, 25160042, 25186950, 25329708, 25499537, 25545807, 25615530, 25723573, 25886450, 26021840, 26058841, 26076170, 26374897, 26414614, 26754172, 26754641, 26758262, 26941262, 26973105, 27036079, 27051467, 27084067, 27345793, 27477018, 27520774, 27522519, 27589997, 27658901, 27789408, 27887626, 27974666, 27995897, 28365005, 28376694, 28483841, 28714976, 28716534, 28789839, 28855300, 28987033, 29278889, 29395285, 29482610, 29486463, 29602048, 29685286, 29723869, 29750252, 29794134, 29880032, 29902745, 30097493, 30258121, 30390679, 30630532, 30859738, 30909239, 30917570, 30924900, 31068200, 31350575, 31413141, 31487521, 31513029, 31607776, 31779670, 31907987, 31915256, 32107424, 32267026, 32614373, 32630447, 32651314, 32830336, 32840654, 32894242, 32941707, 33032659, 33101276, 33198789, 33461764, 33613545, 33839686, 33947463, 34061398, 34172778, 34208838, 34404470, 34576031, 34615897, 34681730, 34739822, 34749609, 34831089, 35191835, 35210353, 35260199, 35379792, 35523454, 35527547, 35672339, 35806110, 35816404, 35864757, 35887031, 35896049, 35912412, 36112222, 36251323, 36750708, 36813542, 36922858, 36966244, 37085492, 37115208, 37198381, 37406134, 37642037, 37990275, 38172904, 38195725, 38226698, 38241287, 38527854, 39273614, 40051009
Alzheimer Disease	Stimulate	26332043, 27887626, 29377401, 31959733
Alzheimer Disease	Inhibit	37239970
Amyotrophic Lateral Sclerosis	Associate	25186950, 25585992, 28302159
Anxiety	Associate	25027412
Aphasia Primary Progressive	Associate	24139279, 30599136
Apraxias	Associate	25027412
Arthritis Rheumatoid	Associate	23146195
Atherosclerosis	Associate	29740051, 35867799
Atrophy	Associate	25027412, 26507310, 36813542
Bone Cysts	Associate	12913093, 22080356, 24886140, 24910390, 25615530, 29720600, 30924900, 31396216, 40301889
Bone Diseases	Associate	26332043, 33486152
Carcinogenesis	Associate	36741909
Carcinoma Basal Cell	Associate	37164949
Carcinoma Hepatocellular	Associate	33955820, 35359989
Carcinoma Renal Cell	Associate	34019793, 35120484
Carotid Stenosis	Inhibit	27148736
Carotid Stenosis	Associate	29740051
Central Nervous System Diseases	Stimulate	26754641
Cerebral Infarction	Associate	30859738
Chronic Kidney Disease Mineral and Bone Disorder	Inhibit	34176389
Chronic Periodontitis	Stimulate	33486152
Cognition Disorders	Associate	25027412, 31724242, 31959733, 35523454, 36966244, 37990275, 40051009
Cognitive Dysfunction	Stimulate	29377401
Cognitive Dysfunction	Associate	31779670
COVID 19	Associate	37848000
Creutzfeldt Jakob Syndrome	Associate	25160042
Cytokine Release Syndrome	Associate	33101276
Death	Associate	40051009
Dementia	Associate	12913093, 23582655, 24899047, 24910390, 25615530, 26076170, 26332043, 26754641, 29480181, 29606617, 29720600, 29750252, 30157425, 30390679, 30530974, 30917570, 30924900, 31396216, 31779670, 31836585, 31907987, 31959733, 32935933, 33101276, 34061398, 34739822, 34831089, 34913545, 35120450, 35623081, 36750708, 37642037, 38226698, 38527854
Dementia	Stimulate	30292090
Demyelinating Diseases	Associate	18790823, 19019460
Depressive Disorder	Associate	35623081
Depressive Disorder Major	Associate	32267026
Diabetes Mellitus	Inhibit	28454543
Diffuse Cerebral Sclerosis of Schilder	Associate	25027412
Diffuse Neurofibrillary Tangles with Calcification	Associate	25499537, 25545807, 36112222
Disease	Associate	25499537, 31413141
Down Syndrome	Associate	29278889, 30909239, 31959733
Drug Related Side Effects and Adverse Reactions	Associate	33461764
Epilepsy	Associate	24910390
Epilepsy Absence	Associate	30152135
Esophageal Neoplasms	Associate	26631031
Esophageal Squamous Cell Carcinoma	Associate	37187751
Essential Tremor	Associate	25585992
Fatty Liver	Associate	37037945
Fibrosis	Associate	34176389
Fractures Bone	Associate	24910390
Frontotemporal Dementia	Associate	23800361, 24041969, 24139279, 24508568, 24910390, 25186950, 26758262, 28716534, 29606617, 30111356, 32935933, 35672339, 36474176, 36799407, 36813542, 37115208, 38226698, 40301889
Frontotemporal Lobar Degeneration	Associate	23582655, 24910390, 28483841
Genetic Diseases Inborn	Associate	24910390, 26332043, 29720600
Glioblastoma	Stimulate	36713360
Glioma	Associate	32684831, 36713360
HIV Infections	Associate	30152135
Huntington Disease	Associate	31724242
Hypothyroidism	Associate	35450027
Inferior Wall Myocardial Infarction	Associate	28987033
Inflammation	Inhibit	18790823, 25186950, 29377401, 29740051, 32684831, 35924849
Inflammation	Associate	23150908, 24899047, 25499537, 25615530, 26184544, 26332043, 31363137, 31724242, 31915256, 31959733, 32267026, 32374474, 33461764, 33506893, 35864757, 35867799, 37481571, 38385291, 39695715, 40138757
Influenza Human	Associate	37990275
Kidney Diseases	Associate	34176389
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	25499537
Leukemia Myeloid Acute	Associate	29956722
Leukodystrophy Metachromatic	Associate	37115208
Leukoencephalopathies	Associate	22080356, 24886140, 24910390, 25027412, 28716534, 29720600, 34061398
Lewy Body Disease	Associate	38527854
Liver Neoplasms	Associate	32941707
Low Tension Glaucoma	Associate	32614373
Lung Neoplasms	Inhibit	33679809
Lymphangioleiomyomatosis	Associate	35359989
Mastocytosis Systemic	Associate	33101276
Melanoma	Associate	26184544, 37187751
Melanoma Cutaneous Malignant	Associate	36741909
Mental Disorders	Associate	25027412, 26332043
Metabolic Syndrome	Associate	36627355
Motor Neuron Disease	Associate	23855984, 36813542
Multiple Sclerosis	Associate	18790823, 19019460, 23855984
Myopathies Structural Congenital	Associate	34220848, 37187751
Necrosis	Associate	23582655
Neoplasms	Associate	26631031, 32684831, 33033253, 33679809, 35359989, 36627355, 36741909, 37164949, 37187751, 40138757
Neoplasms	Stimulate	34019793
Neoplasms	Inhibit	36713360
Nerve Degeneration	Associate	28483841, 29880032, 30917570, 36112222
Nervous System Diseases	Associate	28483841
Neurocognitive Disorders	Associate	26332043, 30152135, 36813542
Neurodegenerative Diseases	Associate	18790823, 23582655, 23800361, 24508568, 25186950, 26058841, 26076170, 26332043, 26374897, 27051467, 27589997, 27974666, 27995897, 28376694, 28483841, 28855300, 28987033, 29278889, 29740051, 30097493, 30390679, 31513029, 31959733, 32107424, 32614373, 33783963, 34061398, 34172778, 35523454, 35672339, 35752680, 35864757, 35912412, 36627355, 36813542, 38226698
Neuroinflammatory Diseases	Associate	25499537, 28376694, 30152135, 36813542
Neurologic Manifestations	Associate	24910390, 31907987
Neuroma Acoustic	Associate	37026948
Obesity	Inhibit	28454543
Obesity	Associate	36627355
Paranoid Disorders	Associate	25027412
Parkinson Disease	Associate	23800361, 24508568, 25186950, 25585992, 26758262
Parkinson Disease	Stimulate	32006615
Parkinson Disease Secondary	Associate	24910390, 26076170
Pathophobia	Associate	25027412
Periodontitis	Associate	33486152, 35450027
Plaque Amyloid	Associate	25186950, 25499537, 28483841, 31350575
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	12080485, 12913093, 12925681, 19019460, 22080356, 23582655, 24886140, 24899047, 24910390, 25615530, 26332043, 26374897, 26754641, 27995897, 28716534, 29606617, 29720600, 30157425, 30924900, 31396216, 32107424, 34061398, 34576123, 35623081, 35672339, 37115208, 38226698, 39879812, 40301889
Pulmonary Disease Chronic Obstructive	Associate	29017955
Renal Insufficiency Chronic	Associate	34176389
Retinal Dystrophies	Associate	36112222
Retrograde Degeneration	Associate	18790823
Sarcoidosis	Stimulate	32508528
Sarcoidosis Pulmonary	Stimulate	26166951
Sarcoidosis Pulmonary	Associate	32508528
Schizophrenia	Stimulate	26332043
Seizures	Associate	24910390
Skin Neoplasms	Associate	37164949
Spinal Cord Injuries	Associate	33506893
Stomach Neoplasms	Associate	33679809
Synucleinopathies	Associate	26076170
Thyroid Cancer Papillary	Stimulate	36438899
Thyroid Neoplasms	Associate	36438899
Tuberculosis	Associate	35924849
Virus Diseases	Associate	29017955
Wounds and Injuries	Associate	34554929
Xeroderma Pigmentosum	Associate	32935933
Xeroderma pigmentosum variant type	Associate	32935933