TREM2 (triggering receptor expressed on myeloid cells 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54209
Gene name Gene Name - the full gene name approved by the HGNC.
Triggering receptor expressed on myeloid cells 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TREM2
Synonyms (NCBI Gene) Gene synonyms aliases
AD17, PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
Disease Acronyms (UniProt) Disease acronyms from UniProt database
AD17, PLOSL2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production o
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT1452413 hsa-miR-1290 CLIP-seq
MIRT1452414 hsa-miR-3167 CLIP-seq
MIRT1452415 hsa-miR-595 CLIP-seq
MIRT1452416 hsa-miR-876-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(98)
GO ID Ontology Definition Evidence Reference
GO:0001530 Function Lipopolysaccharide binding IEA
GO:0001540 Function Amyloid-beta binding IPI 29518356
GO:0001774 Process Microglial cell activation ISS 29518356
GO:0001934 Process Positive regulation of protein phosphorylation ISS 29518356
GO:0002282 Process Microglial cell activation involved in immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605086 17761 ENSG00000095970
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NZC2
Protein name Triggering receptor expressed on myeloid cells 2 (TREM-2) (Triggering receptor expressed on monocytes 2)
Protein function Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP,
PDB 5ELI , 5UD7 , 5UD8 , 6B8O , 6XDS , 6Y6C , 6YMQ , 6YYE , 6Z0G , 6Z0H , 6Z0I , 8T51 , 8T59
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 19 → 129 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, specifically in microglia and in the fusiform gyrus (at protein level) (PubMed:27477018, PubMed:28802038, PubMed:28855300, PubMed:29752066). Expressed on macrophages and dendritic cells but not on granulocytes o
Sequence 
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
QRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT
LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Sequence length 230
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Osteoclast differentiation   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 interactions
DAP12 signaling
Other semaphorin interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (13)
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset, Early-onset autosomal dominant Alzheimer disease, NON RARE IN EUROPE: Alzheimer disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)		 28714976, 24663666, 23380991, 23150908, 30617256, 26891767
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Amyotrophic lateral sclerosis rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 24535663
Apraxia Apraxias rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Developmental regression Developmental regression rs1224421127
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Show/Hide Text Mining Associations (123)
Associations from Text Mining
Disease Name Relationship Type References
AA amyloidosis Associate 26414614, 32840654, 32894242, 33198789, 37990275
Acne Vulgaris Associate 35867799
AIDS Associated Nephropathy Associate 30152135
Alveolitis Extrinsic Allergic Stimulate 32508528
Alzheimer Disease Associate 23150908, 23391427, 23582655, 23800361, 23855982, 23855984, 24041969, 24139279, 24378087, 24439484, 24508568, 24663666, 24899047, 25027412, 25114068
View all (125 more)
Alzheimer Disease Stimulate 26332043, 27887626, 29377401, 31959733
Alzheimer Disease Inhibit 37239970
Amyotrophic Lateral Sclerosis Associate 25186950, 25585992, 28302159
Anxiety Associate 25027412
Aphasia Primary Progressive Associate 24139279, 30599136