KCNK10 (potassium two pore domain channel subfamily K member 10)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 54207
Gene name Potassium two pore domain channel subfamily K member 10
Gene symbol KCNK10
Synonyms (NCBI Gene)
K2p10.1PPP1R97TREK-2TREK2
Chromosome 14
Chromosome location 14q31.3
Summary The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated s
miRNA miRNA information provided by mirtarbase database.
1189
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1189)
miRTarBase ID miRNA Experiments Reference
MIRT542096 hsa-miR-603 HITS-CLIP 23313552
MIRT702515 hsa-miR-6793-3p HITS-CLIP 23313552
MIRT542095 hsa-miR-1284 HITS-CLIP 23313552
MIRT542094 hsa-let-7f-2-3p HITS-CLIP 23313552
MIRT542093 hsa-miR-1185-1-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0005267 Function Potassium channel activity IEA
GO:0005267 Function Potassium channel activity TAS 10880510
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605873 6273 ENSG00000100433
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57789
Protein name Potassium channel subfamily K member 10 (Outward rectifying potassium channel protein TREK-2) (TREK-2 K(+) channel subunit)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate.
PDB 4BW5 , 4XDJ , 4XDK , 4XDL , 8QZ1 , 8QZ2 , 8QZ3 , 8QZ4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 128 → 207 Ion channel Family
PF07885 Ion_trans_2 226 → 324 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: [Isoform A]: Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. In brain, mainly expressed in cerebellum, occipital lobe, putamen, and thalamus. No expression is detected in a
Sequence 
MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ
GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS
PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI
LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS
LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Sequence length 538
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Gastric acid secretion   TWIK related potassium channel (TREK)
Phase 4 - resting membrane potential
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (6)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CENTRAL NERVOUS SYSTEM CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Depressive Disorder Major Associate 29156592
★★★★★
★☆☆☆☆
Found in Text Mining only
Pain Associate 26914156
★★★★★
★☆☆☆☆
Found in Text Mining only
Schizophrenia Associate 26381449
★★★★★
★☆☆☆☆
Found in Text Mining only
Sexual Dysfunctions Psychological Associate 26381449
★★★★★
★☆☆☆☆
Found in Text Mining only