Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5420
Gene name Gene Name - the full gene name approved by the HGNC.
Podocalyxin like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PODXL
Synonyms (NCBI Gene) Gene synonyms aliases
Gp200, PC, PCLP, PCLP-1, PDX, PODXL1, gp135
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PC
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs55698400 T>G Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs1554391082 ->GGCGACGG Likely-pathogenic, uncertain-significance Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001522 hsa-miR-155-5p pSILAC 18668040
MIRT002657 hsa-miR-124-3p Microarray 15685193
MIRT006811 hsa-miR-199b-5p Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 22374871
MIRT006811 hsa-miR-199b-5p Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 22374871
MIRT001522 hsa-miR-155-5p Proteomics;Other 18668040
Transcription factors
Transcription factor Regulation Reference
VDR Unknown 23548800
WT1 Activation 15155752
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001726 Component Ruffle IDA 18456258
GO:0005515 Function Protein binding IPI 22662192
GO:0005615 Component Extracellular space HDA 16502470
GO:0005730 Component Nucleolus IDA
GO:0005737 Component Cytoplasm IDA 18456258
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602632 9171 ENSG00000128567
Protein
UniProt ID O00592
Protein name Podocalyxin (GCTM-2 antigen) (Gp200) (Podocalyxin-like protein 1) (PC) (PCLP-1)
Protein function Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06365 CD34_antigen 358 558 CD34/Podocalyxin family Family
Tissue specificity TISSUE SPECIFICITY: Glomerular epithelium cell (podocyte).
Sequence
MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDT
AQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTI
ESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
PHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVF
HHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLN
LTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALY
GCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIV
PLDNLTKDDLDEEEDTHL
Sequence length 558
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Salmonella infection  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Akinesia Akinesia rs606231129, rs606231131, rs606231132, rs118203995, rs606231133, rs104894299, rs104894300, rs786200904, rs786200905, rs104894294, rs121909254, rs121909255, rs121909256, rs150376433, rs863223335
View all (33 more)
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086
View all (27 more)
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Moyamoya disease Arterial Diseases, Common Carotid rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410 22016802
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Parkinsonian disease atypical juvenile parkinsonism GenCC
Hypertension Hypertension GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 28004467
Adenocarcinoma of Lung Associate 28004467
Albuminuria Associate 24103534
Anophthalmia with pulmonary hypoplasia Associate 33972616
Breast Neoplasms Inhibit 8855966
Breast Neoplasms Associate 8932345
Calcinosis Cutis Associate 23819542, 24668684
Carcinogenesis Associate 28946619
Carcinoma Embryonal Associate 17970049, 30396958
Carcinoma Hepatocellular Associate 15154008