Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54093
Gene name	SET domain containing 4
Gene symbol	SETD4
Synonyms (NCBI Gene)	C21orf18C21orf27
Chromosome	21
Chromosome location	21q22.12

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004168	hsa-miR-192-5p	Microarray	16822819
MIRT004226	hsa-miR-346	Microarray	16822819
MIRT038999	hsa-let-7a-3p	CLASH	23622248
MIRT1340149	hsa-miR-1200	CLIP-seq
MIRT1340150	hsa-miR-1286	CLIP-seq
MIRT1340151	hsa-miR-1470	CLIP-seq
MIRT1340152	hsa-miR-1913	CLIP-seq
MIRT1340153	hsa-miR-1914	CLIP-seq
MIRT1340154	hsa-miR-214	CLIP-seq
MIRT1340155	hsa-miR-2682	CLIP-seq
MIRT1340156	hsa-miR-2861	CLIP-seq
MIRT1340157	hsa-miR-300	CLIP-seq
MIRT1340158	hsa-miR-3153	CLIP-seq
MIRT1340159	hsa-miR-324-3p	CLIP-seq
MIRT1340160	hsa-miR-3619-5p	CLIP-seq
MIRT1340161	hsa-miR-381	CLIP-seq
MIRT1340162	hsa-miR-3922-5p	CLIP-seq
MIRT1340163	hsa-miR-3944-5p	CLIP-seq
MIRT1340164	hsa-miR-4281	CLIP-seq
MIRT1340165	hsa-miR-4286	CLIP-seq
MIRT1340166	hsa-miR-4313	CLIP-seq
MIRT1340167	hsa-miR-4324	CLIP-seq
MIRT1340168	hsa-miR-449c	CLIP-seq
MIRT1340169	hsa-miR-4514	CLIP-seq
MIRT1340170	hsa-miR-4530	CLIP-seq
MIRT1340171	hsa-miR-4649-3p	CLIP-seq
MIRT1340172	hsa-miR-4666-3p	CLIP-seq
MIRT1340173	hsa-miR-4692	CLIP-seq
MIRT1340174	hsa-miR-4700-3p	CLIP-seq
MIRT1340175	hsa-miR-4717-5p	CLIP-seq
MIRT1340176	hsa-miR-4722-5p	CLIP-seq
MIRT1340177	hsa-miR-4749-3p	CLIP-seq
MIRT1340178	hsa-miR-4753-5p	CLIP-seq
MIRT1340179	hsa-miR-4763-5p	CLIP-seq
MIRT1340180	hsa-miR-539	CLIP-seq
MIRT1340181	hsa-miR-544b	CLIP-seq
MIRT1340182	hsa-miR-561	CLIP-seq
MIRT1340183	hsa-miR-579	CLIP-seq
MIRT1340184	hsa-miR-634	CLIP-seq
MIRT1340185	hsa-miR-649	CLIP-seq
MIRT1340186	hsa-miR-761	CLIP-seq
MIRT2100526	hsa-miR-1272	CLIP-seq
MIRT1340150	hsa-miR-1286	CLIP-seq
MIRT2100527	hsa-miR-1324	CLIP-seq
MIRT2100528	hsa-miR-3166	CLIP-seq
MIRT1340163	hsa-miR-3944-5p	CLIP-seq
MIRT1340176	hsa-miR-4722-5p	CLIP-seq
MIRT2100529	hsa-miR-4724-5p	CLIP-seq
MIRT2325230	hsa-miR-1207-3p	CLIP-seq
MIRT2325231	hsa-miR-128	CLIP-seq
MIRT2325232	hsa-miR-149	CLIP-seq
MIRT2325233	hsa-miR-27a	CLIP-seq
MIRT2325234	hsa-miR-27b	CLIP-seq
MIRT2325235	hsa-miR-3064-5p	CLIP-seq
MIRT2325236	hsa-miR-604	CLIP-seq
MIRT2325237	hsa-miR-647	CLIP-seq
MIRT2394258	hsa-miR-105	CLIP-seq
MIRT2394259	hsa-miR-3689d	CLIP-seq
MIRT2394260	hsa-miR-3942-3p	CLIP-seq
MIRT2394261	hsa-miR-4257	CLIP-seq
MIRT2394258	hsa-miR-105	CLIP-seq
MIRT2620973	hsa-miR-1255a	CLIP-seq
MIRT2620974	hsa-miR-1255b	CLIP-seq
MIRT2620975	hsa-miR-1273d	CLIP-seq
MIRT2620976	hsa-miR-1276	CLIP-seq
MIRT2620977	hsa-miR-1280	CLIP-seq
MIRT1340150	hsa-miR-1286	CLIP-seq
MIRT2100527	hsa-miR-1324	CLIP-seq
MIRT2620978	hsa-miR-136	CLIP-seq
MIRT2620979	hsa-miR-140-3p	CLIP-seq
MIRT1340152	hsa-miR-1913	CLIP-seq
MIRT2620980	hsa-miR-198	CLIP-seq
MIRT2620981	hsa-miR-2355-5p	CLIP-seq
MIRT2325235	hsa-miR-3064-5p	CLIP-seq
MIRT2620982	hsa-miR-3120-3p	CLIP-seq
MIRT2100528	hsa-miR-3166	CLIP-seq
MIRT2620983	hsa-miR-3181	CLIP-seq
MIRT2620984	hsa-miR-3189-5p	CLIP-seq
MIRT1340159	hsa-miR-324-3p	CLIP-seq
MIRT2620985	hsa-miR-330-3p	CLIP-seq
MIRT2620986	hsa-miR-361-5p	CLIP-seq
MIRT2620987	hsa-miR-3667-5p	CLIP-seq
MIRT2620988	hsa-miR-3671	CLIP-seq
MIRT1340163	hsa-miR-3944-5p	CLIP-seq
MIRT2620989	hsa-miR-3978	CLIP-seq
MIRT2620990	hsa-miR-409-5p	CLIP-seq
MIRT2620991	hsa-miR-4267	CLIP-seq
MIRT2620992	hsa-miR-4290	CLIP-seq
MIRT2620993	hsa-miR-4639-3p	CLIP-seq
MIRT1340176	hsa-miR-4722-5p	CLIP-seq
MIRT2100529	hsa-miR-4724-5p	CLIP-seq
MIRT2620994	hsa-miR-4726-3p	CLIP-seq
MIRT1340177	hsa-miR-4749-3p	CLIP-seq
MIRT2620995	hsa-miR-4758-3p	CLIP-seq
MIRT1340179	hsa-miR-4763-5p	CLIP-seq
MIRT2620996	hsa-miR-522	CLIP-seq
MIRT2620997	hsa-miR-607	CLIP-seq
MIRT2620973	hsa-miR-1255a	CLIP-seq
MIRT2620974	hsa-miR-1255b	CLIP-seq
MIRT2620975	hsa-miR-1273d	CLIP-seq
MIRT2620977	hsa-miR-1280	CLIP-seq
MIRT1340150	hsa-miR-1286	CLIP-seq
MIRT2100527	hsa-miR-1324	CLIP-seq
MIRT1340152	hsa-miR-1913	CLIP-seq
MIRT2620981	hsa-miR-2355-5p	CLIP-seq
MIRT2100528	hsa-miR-3166	CLIP-seq
MIRT2620984	hsa-miR-3189-5p	CLIP-seq
MIRT1340159	hsa-miR-324-3p	CLIP-seq
MIRT2620986	hsa-miR-361-5p	CLIP-seq
MIRT1340163	hsa-miR-3944-5p	CLIP-seq
MIRT2620989	hsa-miR-3978	CLIP-seq
MIRT2620991	hsa-miR-4267	CLIP-seq
MIRT1340176	hsa-miR-4722-5p	CLIP-seq
MIRT2100529	hsa-miR-4724-5p	CLIP-seq
MIRT2620994	hsa-miR-4726-3p	CLIP-seq
MIRT1340177	hsa-miR-4749-3p	CLIP-seq
MIRT2620995	hsa-miR-4758-3p	CLIP-seq
MIRT1340179	hsa-miR-4763-5p	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	24738023
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	24738023
GO:0005829	Component	Cytosol	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0042799	Function	Histone H4K20 methyltransferase activity	IDA	31308046
GO:0042800	Function	Histone H3K4 methyltransferase activity	IBA
GO:0042800	Function	Histone H3K4 methyltransferase activity	IEA
GO:0042800	Function	Histone H3K4 methyltransferase activity	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046975	Function	Histone H3K36 methyltransferase activity	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0071863	Process	Regulation of cell proliferation in bone marrow	IEA
GO:0071863	Process	Regulation of cell proliferation in bone marrow	ISS
GO:0140941	Function	Histone H4K20me methyltransferase activity	IEA
GO:0140944	Function	Histone H4K20 monomethyltransferase activity	IEA
GO:0140945	Function	Histone H3K4 monomethyltransferase activity	IEA

MIM	HGNC	e!Ensembl
620995	1258	ENSG00000185917

Q9NVD3

Protein name

SET domain-containing protein 4 (EC 2.1.1.-) (EC 2.1.1.364)

Protein function

Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins (PubMed:31308046, PubMed:35545041, PubMed:37926288). Via its catalytic activity, regulates many processes, including cell proliferation, cell differentiati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00856	SET	59 → 273	SET domain	Family
PF09273	Rubis-subs-bind	309 → 425	Rubisco LSMT substrate-binding	Domain

Sequence

MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNLAPACFPGTGR
GLMSQTSLQEGQMIISLPESCLLTTDTVIRSYLGAYITKWKPPPSPLLALCTFLVSEKHA
GHRSLWKPYLEILPKAYTCPVCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSRDFFSSL
QPLFAEAVDSIFSYSALLWAWCTVNTRAVYLRPRQRECLSAEPDTCALAPYLDLLNHSPH
VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR
EILVKYLPSTDKQMDKKISILKDHGYIENLTFGWDGPSWRLLTALKLLCLEAEKFTCWKK
VLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTE
ELKILRASAETLHSLQTAFT

Sequence length

440

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MITRAL VALVE PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	24696725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma Non gestational	Associate	35655916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Inhibit	37879429	★★★★★ ★☆☆☆☆ Found in Text Mining only

SETD4 (SET domain containing 4)