Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5407
Gene name Gene Name - the full gene name approved by the HGNC.	Pancreatic lipase related protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PNLIPRP1
Synonyms (NCBI Gene) Gene synonyms aliases	PLRP1
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q25.3

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004465	Function	Lipoprotein lipase activity	IBA
GO:0004806	Function	Triacylglycerol lipase activity	TAS	1379598
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	1379598
GO:0005615	Component	Extracellular space	IDA	19824014
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0016298	Function	Lipase activity	IDA	19824014
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0034375	Process	High-density lipoprotein particle remodeling	IBA
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

MIM	HGNC	e!Ensembl
604422	9156	ENSG00000187021

Protein

UniProt ID

P54315

Protein name

Inactive pancreatic lipase-related protein 1 (PL-RP1)

Protein function

May function as inhibitor of dietary triglyceride digestion. Lacks detectable lipase activity towards triglycerides, diglycerides, phosphatidylcholine, galactolipids or cholesterol esters (in vitro) (By similarity). {ECO:0000250, ECO:0000269|Pub

PDB

2PPL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00151	Lipase	18 → 353	Lipase	Domain
PF01477	PLAT	358 → 465	PLAT/LH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Pancreas. {ECO:0000269|PubMed:1379598}.

Sequence

MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC

Sequence length

467

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways Pancreatic secretion Fat digestion and absorption		Digestion of dietary lipid

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Glaucoma	Glaucoma	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Adenoid Cystic	Associate	21692051
Carcinoma Pancreatic Ductal	Associate	23918603, 31731384
Pancreatic Neoplasms	Associate	23918603, 31706267
Prostatic Neoplasms	Associate	11384102

PNLIPRP1 (pancreatic lipase related protein 1)