Gene Gene information from NCBI Gene database.
Entrez ID 54039
Gene name Poly(rC) binding protein 3
Gene symbol PCBP3
Synonyms (NCBI Gene)
ALPHA-CP3PCBP3-OT1PCBP3OT
Chromosome 21
Chromosome location 21q22.3
Summary This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
miRNA miRNA information provided by mirtarbase database.
29
miRTarBase ID miRNA Experiments Reference
MIRT018087 hsa-miR-335-5p Microarray 18185580
MIRT029600 hsa-miR-26b-5p Microarray 19088304
MIRT1216541 hsa-miR-338-5p CLIP-seq
MIRT1216542 hsa-miR-4263 CLIP-seq
MIRT1216543 hsa-miR-4799-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608502 8651 ENSG00000183570
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57721
Protein name Poly(rC)-binding protein 3 (Alpha-CP3) (PCBP3-overlapping transcript) (PCBP3-overlapping transcript 1)
Protein function Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 47 109 KH domain Domain
PF00013 KH_1 131 195 KH domain Domain
PF00013 KH_1 295 359 KH domain Domain
Sequence
MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSI
IGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAY
KFEEDIINSMS
NSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTI
SGTPDAIIQCVKQIC
VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQ
LTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINA
R
LTSEVTGMGTL
Sequence length 371
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
18
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Likely benign rs548673780 RCV005871468
Colon adenocarcinoma Likely benign rs548673780 RCV005871465
Colorectal cancer Likely benign rs548673780 RCV005871471
Gastric cancer Likely benign rs548673780 RCV005871472
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Chromosome 21 monosomy Associate 35361402
Pancreatic Neoplasms Associate 35920801
Pulmonary Disease Chronic Obstructive Associate 30694715
Sarcoma Kaposi Associate 40016701