Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54039
Gene name Gene Name - the full gene name approved by the HGNC.	Poly(rC) binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PCBP3
Synonyms (NCBI Gene) Gene synonyms aliases	ALPHA-CP3, PCBP3-OT1, PCBP3OT
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018087	hsa-miR-335-5p	Microarray	18185580
MIRT029600	hsa-miR-26b-5p	Microarray	19088304
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq
MIRT1216545	hsa-miR-1207-5p	CLIP-seq
MIRT1216546	hsa-miR-1262	CLIP-seq
MIRT1216547	hsa-miR-3128	CLIP-seq
MIRT1216548	hsa-miR-3665	CLIP-seq
MIRT1216549	hsa-miR-4701-3p	CLIP-seq
MIRT1216550	hsa-miR-4720-5p	CLIP-seq
MIRT1216551	hsa-miR-4736	CLIP-seq
MIRT1216552	hsa-miR-4763-3p	CLIP-seq
MIRT1216553	hsa-miR-4799-3p	CLIP-seq
MIRT1216554	hsa-miR-760	CLIP-seq
MIRT2465807	hsa-miR-4797-5p	CLIP-seq
MIRT2465808	hsa-miR-759	CLIP-seq
MIRT2588571	hsa-miR-217	CLIP-seq
MIRT2588572	hsa-miR-224	CLIP-seq
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT2588573	hsa-miR-483-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq
MIRT1216541	hsa-miR-338-5p	CLIP-seq
MIRT1216542	hsa-miR-4263	CLIP-seq
MIRT1216543	hsa-miR-4799-5p	CLIP-seq
MIRT1216544	hsa-miR-576-5p	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	10936052
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016071	Process	MRNA metabolic process	NAS
GO:0039694	Process	Viral RNA genome replication	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1990829	Function	C-rich single-stranded DNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
608502	8651	ENSG00000183570

Protein

UniProt ID

P57721

Protein name

Poly(rC)-binding protein 3 (Alpha-CP3) (PCBP3-overlapping transcript) (PCBP3-overlapping transcript 1)

Protein function

Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00013	KH_1	47 → 109	KH domain	Domain
PF00013	KH_1	131 → 195	KH domain	Domain
PF00013	KH_1	295 → 359	KH domain	Domain

Sequence

MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSI
IGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMS
NSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTI
SGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQ
LTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINAR
LTSEVTGMGTL

Sequence length

371

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Myopia	Myopia	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Chromosome 21 monosomy	Associate	35361402
Pancreatic Neoplasms	Associate	35920801
Pulmonary Disease Chronic Obstructive	Associate	30694715
Sarcoma Kaposi	Associate	40016701

PCBP3 (poly(rC) binding protein 3)