CNTN5 (contactin 5)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
53942
Gene name Gene Name - the full gene name approved by the HGNC.
Contactin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNTN5
Synonyms (NCBI Gene) Gene synonyms aliases
HNB-2s, NB-2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the immunoglobulin superfamily, and contactin family, which mediate cell surface interactions during nervous system development. This protein is a glycosylphosphatidylinositol (GPI)-anchored neuronal membran
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT901721 hsa-miR-3149 CLIP-seq
MIRT901722 hsa-miR-494 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane TAS
GO:0007155 Process Cell adhesion IEA
GO:0007605 Process Sensory perception of sound IEA
GO:0098982 Component GABA-ergic synapse IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607219 2175 ENSG00000149972
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O94779
Protein name Contactin-5 (Neural recognition molecule NB-2) (hNB-2)
Protein function Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Probably involved in neuronal activity in the auditory
PDB 4N68 , 5E52
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 104 → 191 Immunoglobulin domain Domain
PF07679 I-set 300 → 386 Immunoglobulin I-set domain Domain
PF07679 I-set 390 → 475 Immunoglobulin I-set domain Domain
PF07679 I-set 482 → 568 Immunoglobulin I-set domain Domain
PF07679 I-set 572 → 667 Immunoglobulin I-set domain Domain
PF00041 fn3 672 → 760 Fibronectin type III domain Domain
PF00041 fn3 877 → 962 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain and kidney and at very low level in placenta. Not expressed in other tissues. In brain, it is highly expressed in the occipital lobe, amygdala, cerebral cortex, frontal lobe, thalamus and temporal lobe. Expressed at
Sequence 
MASSWKLMLFLSVTMCLSEYSKSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLG
TLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDIIFPTDSDEKKVA
LNCEVRGNPVPSYRWLRNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATNTVG
SILSREATLQFAYLGNFSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVA
EDSRRFISQETGNLYISKVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEP
KIEVHFPFTVTAAKGTTVKMECFALGNPVPTITWMKVNGYIPSKARLRKSQAVLEIPNVQ
LDDAGIYECRAENSRGKNSFRGQLQVYTYPHWVEKLNDTQLDSGSPLRWECKATGKPRPT
YRWLKNGVPLSPQSRVEMVNGVLMIHNVNQSDAGMYQCLAENKYGAIYASAELKILASAP
TFALNQLKKTIIVTKDQEVVIECKPQGSPKPTISWKKGDRAVRENKRIAILPDGSLRILN
ASKSDEGKYVCRGENVFGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDAS
LDVTFYWTLKGQPIDFEEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVS
DEAELLVRGPPGPPGIVIVEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVK
TVPEIITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTNV
SGRSGRRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDES
VPPLTPFEVKVGVYNNKGDGPFSQIVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIK
ESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGP
PSSEVSATTKKSPPSQAPSNLRWEQQGSQVSLGWEPVIPLANESEVVGYKVFYRQEGHSN
SQVIETQKLQAVVPLPDAGVYIIEVRAYSEGGDGTASSQIRVPSYSGGKITSAQSTLHSL
STSSSSVTLLLALMIPSTSW
Sequence length 1100
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (12)
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 27089181, 29317604, 29942085 ClinVar
Neuroticism Neuroticism GWAS
Atrial Fibrillation Atrial Fibrillation GWAS
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Show/Hide Text Mining Associations (16)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 20558387, 23577068
Atrial Fibrillation Associate 17903304
Attention Deficit Disorder with Hyperactivity Associate 27166760
Attention Deficit Disorder with Hyperactivity Inhibit 30747104
Autism Spectrum Disorder Associate 27166760, 32807774, 39887962, 40483526
Autistic Disorder Associate 27166760, 30747104
Behcet Syndrome Associate 27548383
Cardiovascular Diseases Associate 17903304, 33441605
Crohn Disease Associate 24707144
Depressive Disorder Associate 32681239