Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53938
Gene name	Peptidylprolyl isomerase like 3
Gene symbol	PPIL3
Synonyms (NCBI Gene)	CYPJ
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531280	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT531279	hsa-miR-4643	PAR-CLIP	22012620
MIRT531278	hsa-miR-875-5p	PAR-CLIP	22012620
MIRT531277	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT531276	hsa-miR-103b	PAR-CLIP	22012620
MIRT531275	hsa-miR-8060	PAR-CLIP	22012620
MIRT531274	hsa-miR-4729	PAR-CLIP	22012620
MIRT531273	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT531272	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT531271	hsa-miR-466	PAR-CLIP	22012620
MIRT531270	hsa-let-7a-3p	PAR-CLIP	22012620
MIRT531269	hsa-let-7b-3p	PAR-CLIP	22012620
MIRT531268	hsa-let-7f-1-3p	PAR-CLIP	22012620
MIRT531267	hsa-miR-98-3p	PAR-CLIP	22012620
MIRT531266	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT531265	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT531264	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT531263	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT531262	hsa-miR-3144-3p	PAR-CLIP	22012620
MIRT531261	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT531260	hsa-miR-5696	PAR-CLIP	22012620
MIRT531259	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531258	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT531280	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT531279	hsa-miR-4643	PAR-CLIP	22012620
MIRT531278	hsa-miR-875-5p	PAR-CLIP	22012620
MIRT531277	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT531276	hsa-miR-103b	PAR-CLIP	22012620
MIRT531275	hsa-miR-8060	PAR-CLIP	22012620
MIRT531274	hsa-miR-4729	PAR-CLIP	22012620
MIRT531273	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT531272	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT531271	hsa-miR-466	PAR-CLIP	22012620
MIRT531270	hsa-let-7a-3p	PAR-CLIP	22012620
MIRT531269	hsa-let-7b-3p	PAR-CLIP	22012620
MIRT531268	hsa-let-7f-1-3p	PAR-CLIP	22012620
MIRT531267	hsa-miR-98-3p	PAR-CLIP	22012620
MIRT531266	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT531265	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT531264	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT531263	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT531262	hsa-miR-3144-3p	PAR-CLIP	22012620
MIRT531261	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT531260	hsa-miR-5696	PAR-CLIP	22012620
MIRT531259	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531258	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT1253234	hsa-miR-1263	CLIP-seq
MIRT1253235	hsa-miR-1322	CLIP-seq
MIRT1253236	hsa-miR-298	CLIP-seq
MIRT1253237	hsa-miR-30a	CLIP-seq
MIRT1253238	hsa-miR-30b	CLIP-seq
MIRT1253239	hsa-miR-30c	CLIP-seq
MIRT1253240	hsa-miR-30d	CLIP-seq
MIRT1253241	hsa-miR-30e	CLIP-seq
MIRT1253242	hsa-miR-376a	CLIP-seq
MIRT1253243	hsa-miR-376b	CLIP-seq
MIRT1253234	hsa-miR-1263	CLIP-seq
MIRT1253244	hsa-miR-1304	CLIP-seq
MIRT1253245	hsa-miR-1972	CLIP-seq
MIRT1253246	hsa-miR-2467-5p	CLIP-seq
MIRT1253247	hsa-miR-3188	CLIP-seq
MIRT1253248	hsa-miR-3613-3p	CLIP-seq
MIRT1253249	hsa-miR-3646	CLIP-seq
MIRT1253250	hsa-miR-3662	CLIP-seq
MIRT1253251	hsa-miR-371b-5p	CLIP-seq
MIRT1253242	hsa-miR-376a	CLIP-seq
MIRT1253243	hsa-miR-376b	CLIP-seq
MIRT1253252	hsa-miR-380	CLIP-seq
MIRT1253253	hsa-miR-3929	CLIP-seq
MIRT1253254	hsa-miR-3975	CLIP-seq
MIRT1253255	hsa-miR-4325	CLIP-seq
MIRT1253256	hsa-miR-4419b	CLIP-seq
MIRT1253257	hsa-miR-4478	CLIP-seq
MIRT1253258	hsa-miR-4495	CLIP-seq
MIRT1253259	hsa-miR-4650-5p	CLIP-seq
MIRT1253260	hsa-miR-4663	CLIP-seq
MIRT1253261	hsa-miR-4717-5p	CLIP-seq
MIRT1253262	hsa-miR-4763-5p	CLIP-seq
MIRT1253263	hsa-miR-4793-3p	CLIP-seq
MIRT1253264	hsa-miR-485-5p	CLIP-seq
MIRT1253265	hsa-miR-548c-3p	CLIP-seq
MIRT1253266	hsa-miR-888	CLIP-seq
MIRT1253236	hsa-miR-298	CLIP-seq
MIRT1253237	hsa-miR-30a	CLIP-seq
MIRT1253238	hsa-miR-30b	CLIP-seq
MIRT1253239	hsa-miR-30c	CLIP-seq
MIRT1253240	hsa-miR-30d	CLIP-seq
MIRT1253241	hsa-miR-30e	CLIP-seq
MIRT1253248	hsa-miR-3613-3p	CLIP-seq
MIRT1253251	hsa-miR-371b-5p	CLIP-seq
MIRT1253262	hsa-miR-4763-5p	CLIP-seq
MIRT1253266	hsa-miR-888	CLIP-seq
MIRT2598240	hsa-miR-198	CLIP-seq
MIRT2598241	hsa-miR-2355-3p	CLIP-seq
MIRT2598242	hsa-miR-338-3p	CLIP-seq
MIRT2598243	hsa-miR-4530	CLIP-seq
MIRT2598244	hsa-miR-4646-3p	CLIP-seq
MIRT2598245	hsa-miR-487a	CLIP-seq
MIRT2598246	hsa-miR-548aa	CLIP-seq
MIRT2598247	hsa-miR-595	CLIP-seq
MIRT2598240	hsa-miR-198	CLIP-seq
MIRT2598241	hsa-miR-2355-3p	CLIP-seq
MIRT2598242	hsa-miR-338-3p	CLIP-seq
MIRT2598243	hsa-miR-4530	CLIP-seq
MIRT2598244	hsa-miR-4646-3p	CLIP-seq
MIRT2598245	hsa-miR-487a	CLIP-seq
MIRT2598246	hsa-miR-548aa	CLIP-seq
MIRT2598247	hsa-miR-595	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18474220, 22365833, 25416956, 32296183, 33961781
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0071013	Component	Catalytic step 2 spliceosome	IBA
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638

MIM	HGNC	e!Ensembl
615811	9262	ENSG00000240344

Q9H2H8

Protein name

Peptidyl-prolyl cis-trans isomerase-like 3 (PPIase) (EC 5.2.1.8) (Cyclophilin J) (CyPJ) (Cyclophilin-like protein PPIL3) (Rotamase PPIL3)

Protein function

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.

PDB

1XYH , 2OJU , 2OK3 , 8C6J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00160	Pro_isomerase	2 → 154	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected at low levels. {ECO:0000269|PubMed:11435694}.

Sequence

MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG
RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK
VIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ

Sequence length

161

Interactions

View interactions

	Reactome
			mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	29193869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	27117709, 32965163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	40642086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	40642086	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPIL3 (peptidylprolyl isomerase like 3)