Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5393
Gene name Gene Name - the full gene name approved by the HGNC.	Exosome component 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EXOSC9
Synonyms (NCBI Gene) Gene synonyms aliases	PCH1D, PM/Scl-75, PMSCL1, RRP45, Rrp45p, p5, p6
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q27
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternati

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139632595	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs372318863	C>G,T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant, missense variant

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000175	Function	3'-5'-RNA exonuclease activity	NAS	11879549
GO:0000176	Component	Nuclear exosome (RNase complex)	IBA
GO:0000176	Component	Nuclear exosome (RNase complex)	IDA	22791713
GO:0000176	Component	Nuclear exosome (RNase complex)	NAS	11879549, 20531386
GO:0000177	Component	Cytoplasmic exosome (RNase complex)	IBA
GO:0000177	Component	Cytoplasmic exosome (RNase complex)	NAS	20531386
GO:0000178	Component	Exosome (RNase complex)	IDA	20531389
GO:0000178	Component	Exosome (RNase complex)	IEA
GO:0000178	Component	Exosome (RNase complex)	NAS	20531386
GO:0000228	Component	Nuclear chromosome	IDA	24105744
GO:0000467	Process	Exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000956	Process	Nuclear-transcribed mRNA catabolic process	IMP	17545563
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	11879549
GO:0004532	Function	RNA exonuclease activity	IDA	17174896
GO:0005515	Function	Protein binding	IPI	12788944, 15231747, 20531386, 24105744, 24981860, 26496610, 30021884, 33961781
GO:0005634	Component	Nucleus	IDA	17545563, 20531386, 22791713
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	2007859
GO:0005654	Component	Nucleoplasm	IDA	24105744
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	22791713
GO:0005730	Component	Nucleolus	IDA	20531386, 22791713, 24105744
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	TAS	2007859
GO:0005737	Component	Cytoplasm	IDA	17545563
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	20531386
GO:0005829	Component	Cytosol	TAS
GO:0006364	Process	RRNA processing	IEA
GO:0006364	Process	RRNA processing	NAS	11879549
GO:0006396	Process	RNA processing	IDA	17174896, 20531386
GO:0006396	Process	RNA processing	IEA
GO:0006401	Process	RNA catabolic process	IDA	17174896, 20531386
GO:0006401	Process	RNA catabolic process	IEA
GO:0006402	Process	MRNA catabolic process	IMP	11782436
GO:0006955	Process	Immune response	NAS	11879549
GO:0016075	Process	RRNA catabolic process	IBA
GO:0030307	Process	Positive regulation of cell growth	IMP	17545563
GO:0034473	Process	U1 snRNA 3'-end processing	IBA
GO:0034475	Process	U4 snRNA 3'-end processing	IBA
GO:0034476	Process	U5 snRNA 3'-end processing	IBA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IBA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	11782436
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0071028	Process	Nuclear mRNA surveillance	IBA
GO:0071028	Process	Nuclear mRNA surveillance	IMP	17545563
GO:0071035	Process	Nuclear polyadenylation-dependent rRNA catabolic process	IBA
GO:0071035	Process	Nuclear polyadenylation-dependent rRNA catabolic process	IMP	16455498
GO:0071038	Process	TRAMP-dependent tRNA surveillance pathway	IBA
GO:0101019	Component	Nucleolar exosome (RNase complex)	NAS	20531386
GO:1905354	Component	Exoribonuclease complex	IEA

MIM	HGNC	e!Ensembl
606180	9137	ENSG00000123737

Protein

UniProt ID

Q06265

Protein name

Exosome complex component RRP45 (Autoantigen PM/Scl 1) (Exosome component 9) (P75 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 1) (Polymyositis/scleroderma autoantigen 75 kDa) (PM/Scl-75)

Protein function

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturat

PDB

2NN6 , 6D6Q , 6D6R , 6H25 , 9G8M , 9G8N , 9G8O , 9G8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01138	RNase_PH	31 → 163		Domain
PF03725	RNase_PH_C	189 → 255		Domain

Sequence

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVS
CELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTES
LCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEER
DPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGI
MLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEK
APIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEG
GGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQ
EKAPSKKPVKRRKKKRAAN

Sequence length

439

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		ATF4 activates genes in response to endoplasmic reticulum stress mRNA decay by 3' to 5' exoribonuclease Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA KSRP (KHSRP) binds and destabilizes mRNA Major pathway of rRNA processing in the nucleolus and cytosol

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Pontoneocerebellar hypoplasia	pontoneocerebellar hypoplasia	rs139632595	N/A
Erythermalgia	pontocerebellar hypoplasia, type 1d	rs139632595, rs372318863	N/A

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	37887339
Mucopolysaccharidoses	Associate	35456399
Neoplasms	Associate	34795329

EXOSC9 (exosome component 9)