Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53919
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier organic anion transporter family member 1C1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLCO1C1
Synonyms (NCBI Gene) Gene synonyms aliases	OATP-F, OATP-RP5, OATP1, OATP14, OATP1C1, OATPF, OATPRP5, SLC21A14
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyro

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1369317	hsa-miR-4698	CLIP-seq
MIRT1369318	hsa-miR-4760-3p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	19129463
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	IDA	12351693, 18566113
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	18687783
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0055085	Process	Transmembrane transport	IDA	12351693, 18566113
GO:0055085	Process	Transmembrane transport	IEA
GO:0070327	Process	Thyroid hormone transport	IDA	12351693, 18566113
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:2000611	Process	Positive regulation of thyroid hormone generation	IMP	18566113

MIM	HGNC	e!Ensembl
613389	13819	ENSG00000139155

Protein

UniProt ID

Q9NYB5

Protein name

Solute carrier organic anion transporter family member 1C1 (Organic anion transporter 1C1) (OATP1C1) (Organic anion transporter F) (OATP-F) (Organic anion transporter polypeptide-related protein 5) (OAT-RP-5) (OATP-RP5) (Organic anion-transporting polypep

Protein function

Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones L-thyroxine (T4), L-thyroxine sulfate (T4S), and 3,3',5'-triiodo-L-thyronine (reverse T3, rT3) at the plasma membrane (PubMed:12351693, PubMed:

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	44 → 638	Organic Anion Transporter Polypeptide (OATP) family	Family
PF07648	Kazal_2	477 → 523	Kazal-type serine protease inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain and in Leydig cells in testis (PubMed:12351693, PubMed:35307651). Localized in nests of Leydig cells (at protein level) (PubMed:12351693). Expressed in choroid plexus (at protein level) (PubMed:18687783). Not

Sequence

MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAV
LFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL

Sequence length

712

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Thyroid hormone signaling pathway		Transport of organic anions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neurodevelopmental Disorders	complex neurodevelopmental disorder	N/A	N/A	GenCC
Obsessive-Compulsive Disorder	Obsessive-compulsive disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Crohn Disease	Associate	36621146
Thyroid Cancer Papillary	Associate	34590520

SLCO1C1 (solute carrier organic anion transporter family member 1C1)