SLCO1C1 (solute carrier organic anion transporter family member 1C1)

Gene

• Entrez ID: 53919
• Gene name: Solute carrier organic anion transporter family member 1C1
• Gene symbol: SLCO1C1
• Synonyms (NCBI Gene): OATP-F, OATP-RP5, OATP1, OATP14, OATP1C1, OATPF, OATPRP5, SLC21A14
• Chromosome: 12
• Chromosome location: 12p12.2
• Summary: This gene encodes a member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1369317	hsa-miR-4698	CLIP-seq
MIRT1369318	hsa-miR-4760-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	19129463
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015349	Function	Thyroid hormone transmembrane transporter activity	IDA	12351693, 18566113
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	18687783
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0055085	Process	Transmembrane transport	IDA	12351693, 18566113
GO:0055085	Process	Transmembrane transport	IEA
GO:0070327	Process	Thyroid hormone transport	IDA	12351693, 18566113
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:2000611	Process	Positive regulation of thyroid hormone generation	IMP	18566113

Other IDs

• MIM: 613389
• HGNC: 13819
• e!Ensembl: ENSG00000139155

Protein

• UniProt ID: Q9NYB5
• Protein name: Solute carrier organic anion transporter family member 1C1 (Organic anion transporter 1C1) (OATP1C1) (Organic anion transporter F) (OATP-F) (Organic anion transporter polypeptide-related protein 5) (OAT-RP-5) (OATP-RP5) (Organic anion-transporting polypep
• Protein function: Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones L-thyroxine (T4), L-thyroxine sulfate (T4S), and 3,3',5'-triiodo-L-thyronine (reverse T3, rT3) at the plasma membrane (PubMed:12351693, PubMed:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03137	OATP	44 → 638	Organic Anion Transporter Polypeptide (OATP) family	Family
  PF07648	Kazal_2	477 → 523	Kazal-type serine protease inhibitor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain and in Leydig cells in testis (PubMed:12351693, PubMed:35307651). Localized in nests of Leydig cells (at protein level) (PubMed:12351693). Expressed in choroid plexus (at protein level) (PubMed:18687783). Not
• Sequence:

  MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
  GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
  VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
  DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
  LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
  RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
  TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
  VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
  KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
  CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
  GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAV
  LFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL

• Sequence length: 712

Pathways

KEGG:

Hormone signaling
Thyroid hormone signaling pathway

Reactome:

Transport of organic anions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Crohn Disease	Associate	36621146	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	34590520	★☆☆☆☆ Found in Text Mining only