Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53841
Gene name Gene Name - the full gene name approved by the HGNC.	Cadherin related family member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDHR5
Synonyms (NCBI Gene) Gene synonyms aliases	MLPCDH, MU-PCDH, MUCDHL, MUPCDH
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motif

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019081	hsa-miR-335-5p	Microarray	18185580
MIRT880105	hsa-miR-1204	CLIP-seq
MIRT880106	hsa-miR-1275	CLIP-seq
MIRT880107	hsa-miR-2277-3p	CLIP-seq
MIRT880108	hsa-miR-3144-5p	CLIP-seq
MIRT880109	hsa-miR-3170	CLIP-seq
MIRT880110	hsa-miR-3189-3p	CLIP-seq
MIRT880111	hsa-miR-3191	CLIP-seq
MIRT880112	hsa-miR-342-5p	CLIP-seq
MIRT880113	hsa-miR-3978	CLIP-seq
MIRT880114	hsa-miR-4651	CLIP-seq
MIRT880115	hsa-miR-4652-5p	CLIP-seq
MIRT880116	hsa-miR-4664-5p	CLIP-seq
MIRT880117	hsa-miR-4665-5p	CLIP-seq
MIRT880118	hsa-miR-491-5p	CLIP-seq
MIRT880119	hsa-miR-608	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	24725409
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007155	Process	Cell adhesion	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IPI	22202456
GO:0016324	Component	Apical plasma membrane	IDA	24725409
GO:0030154	Process	Cell differentiation	IEA
GO:0031526	Component	Brush border membrane	IDA	24725409
GO:0031528	Component	Microvillus membrane	IDA	24725409
GO:0032532	Process	Regulation of microvillus length	IMP	24725409
GO:0044214	Component	Spanning component of plasma membrane	IDA	24725409
GO:0050839	Function	Cell adhesion molecule binding	IDA	24725409
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0090675	Process	Intermicrovillar adhesion	IMP	24725409

MIM	HGNC	e!Ensembl
606839	7521	ENSG00000099834

Protein

UniProt ID

Q9HBB8

Protein name

Cadherin-related family member 5 (Mu-protocadherin) (Mucin and cadherin-like protein) (Mucin-like protocadherin) (MLPCDH)

Protein function

Intermicrovillar adhesion molecule that forms, via its extracellular domain, calcium-dependent heterophilic complexes with CDHR2 on adjacent microvilli. Thereby, controls the packing of microvilli at the apical membrane of epithelial cells. Thro

PDB

6OAE

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highest expression in kidney, liver, colon and small intestine. In kidney, expressed apically along brush border of proximal convoluted tubule but not in cortical collecting ducts. Isoform 1 is expressed primarily in adult small intest

Sequence

MGSWALLWPPLLFTGLLVRPPGTMAQAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEV
TLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDN
APEFPFKTKEIRVEEDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSV
NRPALRLDRPLDFYERPNMTFWLLVRDTPGENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRGINQPIIYSIFRGNVNGTF
IIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQRLYR
GTVARGAGAGVVVKDAAAPSQPLRIQAQDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLAQAGAFYAEVEAHNTVTSGTATTVIEIQVSEQEPPSTDVPPSPEAGGTTGPWTSTTSE
VPRPPEPSQGPSTTSSGGGTGPHPPSGTTLRPPTSSTPGGPPGAENSTSHQPATPGGDTA
QTPKPGTSQPMPPGVGTSTSHQPATPSGGTAQTPEPGTSQPMPPSMGTSTSHQPATPGGG
TAQTPEAGTSQPMPPGMGTSTSHQPTTPGGGTAQTPEPGTSQPMPLSKSTPSSGGGPSED
KRFSVVDMAALGGVLGALLLLALLGLAVLVHKHYGPRLKCCCGKAPEPQPQGFDNQAFLP
DHKANWAPVPSPTHDPKPAEAPMPAEPAPPGPASPGGAPEPPAAARAGGSPTAVRSILTK
ERRPEGGYKAVWFGEDIGTEADVVVLNAPTLDVDGASDSGSGDEGEGAGRGGGPYDAPGG
DDSYI

Sequence length

845

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Hypothyroidism	Hypothyroidism	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	32046242
Brain Ischemia	Associate	32651463
Carcinoma Pancreatic Ductal	Associate	33025744
Colorectal Neoplasms	Associate	27310872, 34929577
Colorectal Neoplasms Hereditary Nonpolyposis	Inhibit	30296522
Cysts	Inhibit	26463459
Neoplasms	Associate	33025744
Polycystic Kidney Autosomal Dominant	Associate	26463459

CDHR5 (cadherin related family member 5)