Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	53841
Gene name	Cadherin related family member 5
Gene symbol	CDHR5
Synonyms (NCBI Gene)	MLPCDHMU-PCDHMUCDHLMUPCDH
Chromosome	11
Chromosome location	11p15.5
Summary	This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motif

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019081	hsa-miR-335-5p	Microarray	18185580
MIRT880105	hsa-miR-1204	CLIP-seq
MIRT880106	hsa-miR-1275	CLIP-seq
MIRT880107	hsa-miR-2277-3p	CLIP-seq
MIRT880108	hsa-miR-3144-5p	CLIP-seq
MIRT880109	hsa-miR-3170	CLIP-seq
MIRT880110	hsa-miR-3189-3p	CLIP-seq
MIRT880111	hsa-miR-3191	CLIP-seq
MIRT880112	hsa-miR-342-5p	CLIP-seq
MIRT880113	hsa-miR-3978	CLIP-seq
MIRT880114	hsa-miR-4651	CLIP-seq
MIRT880115	hsa-miR-4652-5p	CLIP-seq
MIRT880116	hsa-miR-4664-5p	CLIP-seq
MIRT880117	hsa-miR-4665-5p	CLIP-seq
MIRT880118	hsa-miR-491-5p	CLIP-seq
MIRT880119	hsa-miR-608	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	24725409
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24725409
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IDA	32209652
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IPI	22202456
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	24725409
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031526	Component	Brush border membrane	IDA	24725409
GO:0031528	Component	Microvillus membrane	IDA	24725409
GO:0031528	Component	Microvillus membrane	IEA
GO:0032532	Process	Regulation of microvillus length	IMP	24725409
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IBA
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IDA	24725409
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0090675	Process	Intermicrovillar adhesion	IMP	24725409
GO:0098609	Process	Cell-cell adhesion	IBA
GO:1904970	Process	Brush border assembly	IDA	32209652

MIM	HGNC	e!Ensembl
606839	7521	ENSG00000099834

Q9HBB8

Protein name

Cadherin-related family member 5 (Mu-protocadherin) (Mucin and cadherin-like protein) (Mucin-like protocadherin) (MLPCDH)

Protein function

Intermicrovillar adhesion molecule that forms, via its extracellular domain, calcium-dependent heterophilic complexes with CDHR2 on adjacent microvilli. Thereby, controls the packing of microvilli at the apical membrane of epithelial cells. Thro

PDB

6OAE

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highest expression in kidney, liver, colon and small intestine. In kidney, expressed apically along brush border of proximal convoluted tubule but not in cortical collecting ducts. Isoform 1 is expressed primarily in adult small intest

Sequence

MGSWALLWPPLLFTGLLVRPPGTMAQAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEV
TLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDN
APEFPFKTKEIRVEEDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSV
NRPALRLDRPLDFYERPNMTFWLLVRDTPGENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRGINQPIIYSIFRGNVNGTF
IIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQRLYR
GTVARGAGAGVVVKDAAAPSQPLRIQAQDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLAQAGAFYAEVEAHNTVTSGTATTVIEIQVSEQEPPSTDVPPSPEAGGTTGPWTSTTSE
VPRPPEPSQGPSTTSSGGGTGPHPPSGTTLRPPTSSTPGGPPGAENSTSHQPATPGGDTA
QTPKPGTSQPMPPGVGTSTSHQPATPSGGTAQTPEPGTSQPMPPSMGTSTSHQPATPGGG
TAQTPEAGTSQPMPPGMGTSTSHQPTTPGGGTAQTPEPGTSQPMPLSKSTPSSGGGPSED
KRFSVVDMAALGGVLGALLLLALLGLAVLVHKHYGPRLKCCCGKAPEPQPQGFDNQAFLP
DHKANWAPVPSPTHDPKPAEAPMPAEPAPPGPASPGGAPEPPAAARAGGSPTAVRSILTK
ERRPEGGYKAVWFGEDIGTEADVVVLNAPTLDVDGASDSGSGDEGEGAGRGGGPYDAPGG
DDSYI

Sequence length

845

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs146283589	RCV005928952
Clear cell carcinoma of kidney	Uncertain significance	rs114264092	RCV005930754
Colon adenocarcinoma	Uncertain significance	rs150457190	RCV005927201
Gastric cancer	Uncertain significance	rs114264092	RCV005930755
Malignant tumor of esophagus	Uncertain significance	rs114264092	RCV005930753
Sarcoma	Likely benign	rs146283589	RCV005928953

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	32046242
Brain Ischemia	Associate	32651463
Carcinoma Pancreatic Ductal	Associate	33025744
Colorectal Neoplasms	Associate	27310872, 34929577
Colorectal Neoplasms Hereditary Nonpolyposis	Inhibit	30296522
Cysts	Inhibit	26463459
Neoplasms	Associate	33025744
Polycystic Kidney Autosomal Dominant	Associate	26463459

CDHR5 (cadherin related family member 5)