Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53834
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor receptor like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGFRL1
Synonyms (NCBI Gene) Gene synonyms aliases	FGFR-5, FGFR5, FHFR
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affini

Show/Hide all(165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay	19782034
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21044961
MIRT018248	hsa-miR-335-5p	Microarray	18185580
MIRT052346	hsa-let-7b-5p	CLASH	23622248
MIRT329256	hsa-miR-4310	PAR-CLIP	21572407
MIRT329261	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT545443	hsa-miR-3130-3p	PAR-CLIP	21572407
MIRT545442	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT329255	hsa-miR-1827	PAR-CLIP	21572407
MIRT329252	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT329257	hsa-miR-3659	PAR-CLIP	21572407
MIRT163941	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT163942	hsa-miR-107	PAR-CLIP	21572407
MIRT121075	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545441	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT329258	hsa-miR-4658	PAR-CLIP	21572407
MIRT329260	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT121074	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT329254	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT000153	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT163939	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000153	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT163939	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT329256	hsa-miR-4310	PAR-CLIP	21572407
MIRT329261	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT545443	hsa-miR-3130-3p	PAR-CLIP	21572407
MIRT545442	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT329255	hsa-miR-1827	PAR-CLIP	21572407
MIRT329252	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT329257	hsa-miR-3659	PAR-CLIP	21572407
MIRT163941	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT163942	hsa-miR-107	PAR-CLIP	21572407
MIRT121075	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545441	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT329258	hsa-miR-4658	PAR-CLIP	21572407
MIRT329260	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT121074	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT329254	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996239	hsa-miR-1231	CLIP-seq
MIRT996240	hsa-miR-1285	CLIP-seq
MIRT996241	hsa-miR-1299	CLIP-seq
MIRT996242	hsa-miR-1343	CLIP-seq
MIRT996243	hsa-miR-140-3p	CLIP-seq
MIRT996244	hsa-miR-150	CLIP-seq
MIRT996245	hsa-miR-185	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996247	hsa-miR-21	CLIP-seq
MIRT996248	hsa-miR-210	CLIP-seq
MIRT996249	hsa-miR-296-5p	CLIP-seq
MIRT996250	hsa-miR-3187-5p	CLIP-seq
MIRT996251	hsa-miR-3621	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996253	hsa-miR-3665	CLIP-seq
MIRT996254	hsa-miR-3687	CLIP-seq
MIRT996255	hsa-miR-3688-5p	CLIP-seq
MIRT996256	hsa-miR-3713	CLIP-seq
MIRT996257	hsa-miR-3714	CLIP-seq
MIRT996258	hsa-miR-3937	CLIP-seq
MIRT996259	hsa-miR-4281	CLIP-seq
MIRT996260	hsa-miR-4306	CLIP-seq
MIRT996261	hsa-miR-4313	CLIP-seq
MIRT996262	hsa-miR-4442	CLIP-seq
MIRT996263	hsa-miR-4449	CLIP-seq
MIRT996264	hsa-miR-4470	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996265	hsa-miR-4520a-5p	CLIP-seq
MIRT996266	hsa-miR-4520b-5p	CLIP-seq
MIRT996267	hsa-miR-4532	CLIP-seq
MIRT996268	hsa-miR-4644	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996269	hsa-miR-4652-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996271	hsa-miR-4690-3p	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT996272	hsa-miR-4711-3p	CLIP-seq
MIRT996273	hsa-miR-4736	CLIP-seq
MIRT996274	hsa-miR-4768-3p	CLIP-seq
MIRT996275	hsa-miR-4786-5p	CLIP-seq
MIRT996276	hsa-miR-517b	CLIP-seq
MIRT996277	hsa-miR-590-5p	CLIP-seq
MIRT996278	hsa-miR-593	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996279	hsa-miR-612	CLIP-seq
MIRT996280	hsa-miR-622	CLIP-seq
MIRT996281	hsa-miR-665	CLIP-seq
MIRT996282	hsa-miR-875-3p	CLIP-seq
MIRT996283	hsa-miR-940	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996239	hsa-miR-1231	CLIP-seq
MIRT1995379	hsa-miR-1304	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996248	hsa-miR-210	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996254	hsa-miR-3687	CLIP-seq
MIRT996256	hsa-miR-3713	CLIP-seq
MIRT996262	hsa-miR-4442	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996265	hsa-miR-4520a-5p	CLIP-seq
MIRT996266	hsa-miR-4520b-5p	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT1995380	hsa-miR-4742-5p	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996280	hsa-miR-622	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT1995379	hsa-miR-1304	CLIP-seq
MIRT2229444	hsa-miR-134	CLIP-seq
MIRT2229445	hsa-miR-1973	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT2229446	hsa-miR-3118	CLIP-seq
MIRT2229447	hsa-miR-3164	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996257	hsa-miR-3714	CLIP-seq
MIRT2229448	hsa-miR-3922-5p	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT2229449	hsa-miR-4800-3p	CLIP-seq
MIRT996276	hsa-miR-517b	CLIP-seq
MIRT2229450	hsa-miR-592	CLIP-seq
MIRT2229451	hsa-miR-597	CLIP-seq
MIRT2229452	hsa-miR-3163	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT2533341	hsa-miR-1275	CLIP-seq
MIRT2533342	hsa-miR-1908	CLIP-seq
MIRT2533343	hsa-miR-2114	CLIP-seq
MIRT2533344	hsa-miR-3153	CLIP-seq
MIRT2533345	hsa-miR-3197	CLIP-seq
MIRT2533346	hsa-miR-4259	CLIP-seq
MIRT2533347	hsa-miR-4525	CLIP-seq
MIRT2533348	hsa-miR-4665-5p	CLIP-seq
MIRT2533349	hsa-miR-4706	CLIP-seq
MIRT2533350	hsa-miR-4723-5p	CLIP-seq
MIRT2533351	hsa-miR-4749-5p	CLIP-seq
MIRT2533352	hsa-miR-556-5p	CLIP-seq
MIRT2533353	hsa-miR-571	CLIP-seq
MIRT2533354	hsa-miR-625	CLIP-seq
MIRT2533355	hsa-miR-663	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005007	Function	Fibroblast growth factor-activated receptor activity	IBA	21873635
GO:0005007	Function	Fibroblast growth factor-activated receptor activity	IDA	12813049
GO:0005794	Component	Golgi apparatus	IDA	18061161
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	12813049, 18061161
GO:0005886	Component	Plasma membrane	TAS
GO:0008201	Function	Heparin binding	IDA	12813049
GO:0008201	Function	Heparin binding	IMP	18061161
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0017134	Function	Fibroblast growth factor binding	IBA	21873635
GO:0030133	Component	Transport vesicle	IDA	18061161
GO:0042802	Function	Identical protein binding	IPI	18061161
GO:0044291	Component	Cell-cell contact zone	IDA	18061161
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IMP	18061161

MIM	HGNC	e!Ensembl
605830	3693	ENSG00000127418

Protein

UniProt ID

Q8N441

Protein name

Fibroblast growth factor receptor-like 1 (FGF receptor-like protein 1) (FGF homologous factor receptor) (FGFR-like protein) (Fibroblast growth factor receptor 5) (FGFR-5)

Protein function

Has a negative effect on cell proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	29 → 116	Immunoglobulin I-set domain	Domain
PF07679	I-set	147 → 238	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	245 → 342		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed preferentially in cartilaginous tissues and pancreas. Highly expressed in the liver, kidney, heart, brain and skeletal muscle. Weakly expressed in the lung, small intestine and spleen. {ECO:0000269|PubMed:11031111, ECO:000026

Sequence

MTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPL
TMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDI
SPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRP
DITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQ
RTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG
QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPK
PPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPP
GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKLYTDIHT
HTHTHSHTHSHVEGKVHQHIHYQC

Sequence length

504

Interactions

View interactions

	Reactome
			FGFRL1 modulation of FGFR1 signaling

Show/Hide Causal Diseases (13)

Disease term	Disease name	dbSNP ID	References
Causal
Axenfeld anomaly	Rieger eye malformation sequence	rs104893857, rs1560590094, rs104893858, rs1198152064, rs104893859, rs104893860, rs121909249, rs104893862, rs104893957, rs104893951, rs104893952, rs104893953, rs121909339, rs387906810, rs372857241 View all (33 more)
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	rs121908602, rs121908604, rs864309713, rs775394591	20938900
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Hemangioma	Hemangioma	rs121917766
Mental retardation	Severe intellectual disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Precocious puberty	Precocious Puberty	rs879255238, rs879255239, rs879255240, rs1264639964, rs1566764505
Radioulnar synostosis	Radioulnar Synostosis	rs1595756416, rs1595756703, rs1231501584, rs1595756962, rs1595757203, rs1595763070, rs1595766210
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775
Wolf-hirschhorn syndrome	Wolf-Hirschhorn Syndrome	rs1560602800, rs1560635105, rs1560696317

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Ptosis	Blepharoptosis, Ptosis	ClinVar
Diabetes	Diabetes	GWAS
Gout	Gout	GWAS
Atrial Fibrillation	Atrial Fibrillation	GWAS

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining
Adamantinoma	Associate	29241927
Brain Diseases	Associate	31396565
Carcinoma Non Small Cell Lung	Associate	31919528
Carcinoma Pancreatic Ductal	Associate	34061869
Cleft Lip	Associate	29241927
Colorectal Neoplasms	Associate	25193853
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	29241927
Esophageal Neoplasms	Associate	37116156
Esophageal Squamous Cell Carcinoma	Associate	21044961
Facial Dysmorphism with Multiple Malformations	Associate	29241927
Gastroschisis	Associate	32163230
Genetic Diseases Inborn	Associate	32416892
Hernias Diaphragmatic Congenital	Associate	33443296
Hypertension	Associate	35980984
Lung Diseases	Associate	32396269
Lung Neoplasms	Associate	29371906, 32396269
Muscular Diseases	Associate	33443296
Neoplasm Metastasis	Associate	32396269
Neoplasms	Associate	21044961, 23775577, 26015570, 29371906
Obesity	Associate	28211912
Osteoporosis	Associate	35980984
Ovarian Neoplasms	Associate	23571109, 26015570
Pancreatic Neoplasms	Associate	37130628
Prostatic Neoplasms	Associate	37929340
Respiratory Distress Syndrome	Associate	33443296
Urinary Bladder Neoplasms	Inhibit	23775577
Weight Loss	Stimulate	34139469
Wolf Hirschhorn Syndrome	Associate	18830230, 29241927, 32416892, 33443296

FGFRL1 (fibroblast growth factor receptor like 1)