Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53832
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 20 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL20RA
Synonyms (NCBI Gene) Gene synonyms aliases	CRF2-8, IL-20R-alpha, IL-20R1, IL-20RA
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisti

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029093	hsa-miR-26b-5p	Microarray	19088304
MIRT1064490	hsa-miR-1236	CLIP-seq
MIRT1064491	hsa-miR-1262	CLIP-seq
MIRT1064492	hsa-miR-2054	CLIP-seq
MIRT1064493	hsa-miR-3115	CLIP-seq
MIRT1064494	hsa-miR-3180-5p	CLIP-seq
MIRT1064495	hsa-miR-3675-3p	CLIP-seq
MIRT1064496	hsa-miR-3689a-5p	CLIP-seq
MIRT1064497	hsa-miR-3689b	CLIP-seq
MIRT1064498	hsa-miR-3689e	CLIP-seq
MIRT1064499	hsa-miR-3689f	CLIP-seq
MIRT1064500	hsa-miR-380	CLIP-seq
MIRT1064501	hsa-miR-4289	CLIP-seq
MIRT1064502	hsa-miR-4307	CLIP-seq
MIRT1064503	hsa-miR-4636	CLIP-seq
MIRT1064504	hsa-miR-4701-3p	CLIP-seq
MIRT1064505	hsa-miR-508-5p	CLIP-seq
MIRT1064506	hsa-miR-520a-5p	CLIP-seq
MIRT1064507	hsa-miR-525-5p	CLIP-seq
MIRT1064508	hsa-miR-942	CLIP-seq
MIRT1550115	hsa-miR-3171	CLIP-seq
MIRT1550116	hsa-miR-493	CLIP-seq
MIRT1550117	hsa-miR-550a	CLIP-seq
MIRT1550118	hsa-miR-630	CLIP-seq
MIRT1064505	hsa-miR-508-5p	CLIP-seq
MIRT2015339	hsa-miR-580	CLIP-seq
MIRT1550115	hsa-miR-3171	CLIP-seq
MIRT1550116	hsa-miR-493	CLIP-seq
MIRT1550117	hsa-miR-550a	CLIP-seq
MIRT1550118	hsa-miR-630	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	22802649
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0042015	Function	Interleukin-20 binding	IBA	21873635
GO:0045124	Process	Regulation of bone resorption	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
605620	6003	ENSG00000016402

Protein

UniProt ID

Q9UHF4

Protein name

Interleukin-20 receptor subunit alpha (IL-20 receptor subunit alpha) (IL-20R-alpha) (IL-20RA) (Cytokine receptor class-II member 8) (Cytokine receptor family 2 member 8) (CRF2-8) (IL-20R1) (ZcytoR7)

Protein function

The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.

PDB

4DOH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01108	Tissue_fac	14 → 123	Tissue factor	Family
PF09294	Interfer-bind	135 → 240	Interferon-alpha/beta receptor, fibronectin type III	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. {ECO:0000269|PubMed:11163236, ECO:0000269|PubMed:14764663}.

Sequence

MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK
YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL
KDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL
GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV
DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ
FMEEWGLYVQMEN

Sequence length

553

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway		Interleukin-20 family signaling

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Biliary Cholangitis	Biliary Cholangitis	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	31831038
Breast Neoplasms	Associate	16710719
Carcinoid Tumor	Associate	23929435
Diabetes Mellitus Type 2	Associate	27655316
Inflammation	Associate	40133606
Lung Neoplasms	Associate	19017733
Lymphoma B Cell Marginal Zone	Associate	28152507
Malaria	Associate	23614351
Mouth Diseases	Inhibit	16645593
Neoplasms	Inhibit	19017733
Urinary Bladder Neoplasms	Associate	23271730

IL20RA (interleukin 20 receptor subunit alpha)