Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5371
Gene name Gene Name - the full gene name approved by the HGNC.
PML nuclear body scaffold
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PML
Synonyms (NCBI Gene) Gene synonyms aliases
MYL, PP8675, RNF71, TRIM19
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies wh
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018318 hsa-miR-335-5p Microarray 18185580
MIRT043919 hsa-miR-378a-3p CLASH 23622248
MIRT042535 hsa-miR-423-3p CLASH 23622248
MIRT042535 hsa-miR-423-3p CLASH 23622248
MIRT1244408 hsa-miR-1227 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ARID3A Activation 22010578
IRF9 Activation 8681971
PML Activation 15529177
STAT1 Activation 21115099;22589541
STAT1 Unknown 15519999
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region IDA 26119943
GO:0000785 Component Chromatin IBA 21873635
GO:0000792 Component Heterochromatin IEA
GO:0001666 Process Response to hypoxia IDA 16915281
GO:0001932 Process Regulation of protein phosphorylation ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
102578 9113 ENSG00000140464
Protein
UniProt ID P29590
Protein name Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)
Protein function Functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms. A
PDB 1BOR , 2MVW , 2MWX , 4WJN , 4WJO , 5YUF , 6IMQ , 6UYO , 6UYP , 6UYQ , 6UYR , 6UYS , 6UYT , 6UYU , 6UYV , 8DJH , 8DJI , 8J25 , 8J2P , 8YTC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00643 zf-B_box 124 166 B-box zinc finger Domain
PF12126 DUF3583 240 570 Protein of unknown function (DUF3583) Family
Sequence
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENS
SSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS
Sequence length 882
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis
Endocytosis
Influenza A
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
  SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Regulation of TP53 Activity through Acetylation
Interferon gamma signaling
Regulation of RUNX1 Expression and Activity
Regulation of PTEN localization
HCMV Early Events
Transcriptional regulation of granulopoiesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Glioblastoma Glioblastoma, Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888 23440206
Hypofibrinogenemia Hypofibrinogenemia rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604
Myopia Myopia, Degenerative rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805
View all (6 more)
23049088
Unknown
Disease term Disease name Evidence References Source
Exfoliation syndrome Exfoliation Syndrome 24938310 ClinVar
Myocardial infarction Myocardial Infarction 21211798 ClinVar
Diabetes Diabetes GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute erythroleukemia Associate 11552979
Acute Retroviral Syndrome Associate 15589835, 26566030
Adenoviridae Infections Associate 7559785
Alternating hemiplegia of childhood Associate 21037079, 23260199, 24413054, 24709898, 25259924, 30226859, 31278054
Alzheimer Disease Associate 26444770
Aortic Dissection Associate 33083483
Arthritis Rheumatoid Associate 17360386
Ataxia Associate 10669754
Blood Coagulation Disorders Associate 20133705
Brain Neoplasms Associate 24487962