Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53635
Gene name Gene Name - the full gene name approved by the HGNC.	PTOV1 extended AT-hook containing adaptor protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTOV1
Synonyms (NCBI Gene) Gene synonyms aliases	ACID2, PTOV-1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that was found to be overexpressed in prostate adenocarcinomas. The encoded protein was found to interact with the lipid raft protein flotillin-1 and shuttle it from the cytoplasm to the nucleus in a cell cycle dependent manner

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045949	hsa-miR-125b-5p	CLASH	23622248
MIRT044008	hsa-miR-378a-5p	CLASH	23622248
MIRT1273766	hsa-miR-1288	CLIP-seq
MIRT1273767	hsa-miR-3144-5p	CLIP-seq
MIRT1273768	hsa-miR-3189-3p	CLIP-seq
MIRT1273769	hsa-miR-3191	CLIP-seq
MIRT1273770	hsa-miR-3199	CLIP-seq
MIRT1273771	hsa-miR-4287	CLIP-seq
MIRT1273772	hsa-miR-432	CLIP-seq
MIRT1273773	hsa-miR-4443	CLIP-seq
MIRT1273774	hsa-miR-4469	CLIP-seq
MIRT1273775	hsa-miR-4651	CLIP-seq
MIRT1273776	hsa-miR-4652-5p	CLIP-seq
MIRT1273777	hsa-miR-4685-3p	CLIP-seq
MIRT1273778	hsa-miR-491-5p	CLIP-seq
MIRT1273779	hsa-miR-608	CLIP-seq
MIRT1273780	hsa-miR-642a	CLIP-seq
MIRT2080511	hsa-miR-4706	CLIP-seq
MIRT2080512	hsa-miR-4734	CLIP-seq
MIRT2080513	hsa-miR-4749-5p	CLIP-seq
MIRT2080514	hsa-miR-593	CLIP-seq
MIRT2080515	hsa-miR-744	CLIP-seq
MIRT2306639	hsa-miR-1197	CLIP-seq
MIRT2306640	hsa-miR-1226	CLIP-seq
MIRT2306641	hsa-miR-3612	CLIP-seq
MIRT2306642	hsa-miR-3664-3p	CLIP-seq
MIRT1273772	hsa-miR-432	CLIP-seq
MIRT2306643	hsa-miR-4436a	CLIP-seq
MIRT2306644	hsa-miR-4438	CLIP-seq
MIRT1273773	hsa-miR-4443	CLIP-seq
MIRT2306645	hsa-miR-4447	CLIP-seq
MIRT2306646	hsa-miR-4472	CLIP-seq
MIRT2306647	hsa-miR-4488	CLIP-seq
MIRT2306648	hsa-miR-4697-5p	CLIP-seq
MIRT2306649	hsa-miR-4701-5p	CLIP-seq
MIRT2080511	hsa-miR-4706	CLIP-seq
MIRT2306650	hsa-miR-4733-3p	CLIP-seq
MIRT2080512	hsa-miR-4734	CLIP-seq
MIRT2080513	hsa-miR-4749-5p	CLIP-seq
MIRT2306651	hsa-miR-588	CLIP-seq
MIRT2080514	hsa-miR-593	CLIP-seq
MIRT2306652	hsa-miR-650	CLIP-seq
MIRT2080515	hsa-miR-744	CLIP-seq
MIRT2439705	hsa-miR-3940-3p	CLIP-seq
MIRT2439706	hsa-miR-4532	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005886	Component	Plasma membrane	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
610195	9632	ENSG00000104960

Protein

UniProt ID

Q86YD1

Protein name

Prostate tumor-overexpressed gene 1 protein (PTOV-1) (Activator interaction domain-containing protein 2)

Protein function

May activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11232	Med25	89 → 238	Mediator complex subunit 25 PTOV activation and synapsin 2	Domain
PF11232	Med25	254 → 399	Mediator complex subunit 25 PTOV activation and synapsin 2	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, placenta, skeletal muscle and small intestine. {ECO:0000269|PubMed:11313889}.

Sequence

MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGA
RVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLP
CQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCR
IMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVSAIRQVITTRKQAV
GPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPR
KLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCE
IRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG

Sequence length

416

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	21364753

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining
Atrophy	Associate	22507319
Breast Neoplasms	Associate	24947166, 34131286
Carcinogenesis	Associate	28651486
Carcinoma Hepatocellular	Associate	25634174
Carcinoma Ovarian Epithelial	Associate	25270739
Diabetes Mellitus Type 2	Associate	40141237
Esophageal Squamous Cell Carcinoma	Associate	28651486
Lymphatic Metastasis	Associate	26305455
Nasopharyngeal Carcinoma	Associate	26305455
Neoplasms	Associate	24947166, 25270739, 26305455, 26992242, 28651486, 34440306, 34654719, 34918668
Neoplasms	Inhibit	31083670
Osteosarcoma	Associate	34440306
Prostatic Intraepithelial Neoplasia	Stimulate	12598323
Prostatic Intraepithelial Neoplasia	Associate	22507319
Prostatic Neoplasms	Associate	12598323, 22507319, 26992242, 34654719
Prostatic Neoplasms	Stimulate	25634174, 34918668
Prostatitis	Associate	12598323
Squamous Cell Carcinoma of Head and Neck	Associate	26992242
Tertiary Lymphoid Structures	Stimulate	28651486
Urethral Neoplasms	Associate	26746655
Urinary Bladder Neoplasms	Associate	37269345
Uterine Cervical Dysplasia	Stimulate	34918668

PTOV1 (PTOV1 extended AT-hook containing adaptor protein)