Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
53632
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase AMP-activated non-catalytic subunit gamma 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRKAG3
Synonyms (NCBI Gene) Gene synonyms aliases
AMPKG3, SMGMQTL
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs138130157 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1262452 hsa-miR-103a CLIP-seq
MIRT1262453 hsa-miR-107 CLIP-seq
MIRT1262454 hsa-miR-1184 CLIP-seq
MIRT1262455 hsa-miR-4310 CLIP-seq
MIRT1262456 hsa-miR-4418 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004679 Function AMP-activated protein kinase activity IEA
GO:0004679 Function AMP-activated protein kinase activity TAS 10698692
GO:0005515 Function Protein binding IPI 28514442, 32296183, 32707033, 33961781
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604976 9387 ENSG00000115592
Protein
UniProt ID Q9UGI9
Protein name 5'-AMP-activated protein kinase subunit gamma-3 (AMPK gamma3) (AMPK subunit gamma-3)
Protein function AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:14722619, PubMed:17878938, PubMed:24563466). In response to reduction of intra
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00571 CBS 273 333 CBS domain Domain
PF00571 CBS 352 406 CBS domain Domain
PF00571 CBS 417 479 CBS domain Domain
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle, with weak expression in heart and pancreas.
Sequence
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHI
FGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAA
QQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVL
S
PAGIDALGA
Sequence length 489
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Apelin signaling pathway
Tight junction
Circadian rhythm
Thermogenesis
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease
Alcoholic liver disease
Hypertrophic cardiomyopathy
  Macroautophagy
Energy dependent regulation of mTOR by LKB1-AMPK
TP53 Regulates Metabolic Genes
Regulation of TP53 Activity through Phosphorylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 28582508
Diabetes Mellitus Type 2 Associate 34589546
Lymphoma Large B Cell Diffuse Associate 23396962
Lymphoma Non Hodgkin Associate 23396962
Obesity Associate 17878938
Triple Negative Breast Neoplasms Associate 22140552, 28582508
Wolff Parkinson White Syndrome Associate 17878938, 27866917