Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5354
Gene name Gene Name - the full gene name approved by the HGNC.	Proteolipid protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLP1
Synonyms (NCBI Gene) Gene synonyms aliases	GPM6C, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq22.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axona

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT545028	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545029	hsa-miR-586	PAR-CLIP	21572407
MIRT545027	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551510	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT545026	hsa-miR-567	PAR-CLIP	21572407
MIRT545025	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545023	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545024	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545022	hsa-miR-3924	PAR-CLIP	21572407
MIRT551509	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT545021	hsa-miR-6844	PAR-CLIP	21572407
MIRT551508	hsa-miR-4666b	PAR-CLIP	21572407
MIRT545020	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT545019	hsa-miR-297	PAR-CLIP	21572407
MIRT545018	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT545017	hsa-miR-147a	PAR-CLIP	21572407
MIRT545016	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT545028	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545029	hsa-miR-586	PAR-CLIP	21572407
MIRT545027	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT545026	hsa-miR-567	PAR-CLIP	21572407
MIRT545025	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545023	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545024	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545022	hsa-miR-3924	PAR-CLIP	21572407
MIRT545021	hsa-miR-6844	PAR-CLIP	21572407
MIRT545020	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT545019	hsa-miR-297	PAR-CLIP	21572407
MIRT545018	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT545017	hsa-miR-147a	PAR-CLIP	21572407
MIRT545016	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT735693	hsa-miR-485-3p	Microarray	32006661
MIRT545028	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545029	hsa-miR-586	PAR-CLIP	21572407
MIRT545027	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551510	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT545026	hsa-miR-567	PAR-CLIP	21572407
MIRT545025	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545023	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545024	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545022	hsa-miR-3924	PAR-CLIP	21572407
MIRT551509	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT545021	hsa-miR-6844	PAR-CLIP	21572407
MIRT551508	hsa-miR-4666b	PAR-CLIP	21572407
MIRT545020	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT545019	hsa-miR-297	PAR-CLIP	21572407
MIRT545018	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT545017	hsa-miR-147a	PAR-CLIP	21572407
MIRT545016	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT545028	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545029	hsa-miR-586	PAR-CLIP	21572407
MIRT545027	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT545026	hsa-miR-567	PAR-CLIP	21572407
MIRT545025	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545023	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545024	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545022	hsa-miR-3924	PAR-CLIP	21572407
MIRT545021	hsa-miR-6844	PAR-CLIP	21572407
MIRT545020	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT545019	hsa-miR-297	PAR-CLIP	21572407
MIRT545018	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT545017	hsa-miR-147a	PAR-CLIP	21572407
MIRT545016	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT1243095	hsa-miR-1273d	CLIP-seq
MIRT1243096	hsa-miR-197	CLIP-seq
MIRT1243097	hsa-miR-3123	CLIP-seq
MIRT1243098	hsa-miR-3671	CLIP-seq
MIRT1243099	hsa-miR-4311	CLIP-seq
MIRT1243100	hsa-miR-4461	CLIP-seq
MIRT1243101	hsa-miR-4762-5p	CLIP-seq
MIRT1243102	hsa-miR-607	CLIP-seq
MIRT2071828	hsa-miR-3074-3p	CLIP-seq
MIRT2298955	hsa-miR-3133	CLIP-seq
MIRT2298956	hsa-miR-3714	CLIP-seq
MIRT2298957	hsa-miR-518a-5p	CLIP-seq
MIRT2298958	hsa-miR-527	CLIP-seq
MIRT2298959	hsa-miR-548an	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	TAS	2479017
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 26871637, 26960425, 32296183, 32814053, 35217805
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24103481
GO:0005886	Component	Plasma membrane	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	2479017
GO:0008366	Process	Axon ensheathment	IEA
GO:0008366	Process	Axon ensheathment	TAS	2479017
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014002	Process	Astrocyte development	IEA
GO:0016020	Component	Membrane	IEA
GO:0019911	Function	Structural constituent of myelin sheath	IBA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022010	Process	Central nervous system myelination	IBA
GO:0022010	Process	Central nervous system myelination	IEA
GO:0042552	Process	Myelination	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IPI	17962415
GO:0043209	Component	Myelin sheath	IBA
GO:0043209	Component	Myelin sheath	IEA
GO:0045202	Component	Synapse	IEA
GO:0061564	Process	Axon development	IBA
GO:0061564	Process	Axon development	IEA

MIM	HGNC	e!Ensembl
300401	9086	ENSG00000123560

Protein

UniProt ID

P60201

Protein name

Myelin proteolipid protein (PLP) (Lipophilin)

Protein function

This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.

PDB

2XPG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01275	Myelin_PLP	3 → 273	Myelin proteolipid protein (PLP or lipophilin)	Family

Sequence

MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEY
LINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGG
QKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNT
WTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLF
IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Sequence length

277

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hereditary spastic paraplegia	Hereditary spastic paraplegia 2	rs132630291, rs1556267287, rs786205605, rs1135401759, rs1602385672, rs132630292, rs797045064, rs1556273167, rs864622194, rs1602384101, rs878853076, rs1602373055, rs132630294, rs886039537, rs132630288 View all (6 more)	N/A
Pelizaeus-Merzbacher disease	pelizaeus-merzbacher disease, Pelizaeus-Merzbacher disease, connatal	rs1602383261, rs398123467, rs132630280, rs1060500909, rs132630291, rs1602383268, rs132630281, rs1556270312, rs797045064, rs132630282, rs1556267215, rs1569427311, rs132630284, rs1569427275, rs132630292 View all (22 more)	N/A
Hypomyelinating Leukodystrophy	pelizaeus-merzbacher disease, atypical	rs132630292	N/A
Mental retardation	intellectual disability	rs1556270312	N/A

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Inhibit	18708408
Alcohol Related Disorders	Associate	21679407
Cerebral Palsy	Associate	18437021
Chromosome Duplication	Associate	31951325
Cognition Disorders	Associate	36622199
Colorectal Neoplasms	Inhibit	19661077
Colorectal Neoplasms	Associate	32797167
COVID 19	Associate	17392370
Demyelinating Diseases	Associate	12297985, 14681886, 17962415, 19562355, 2479017, 27179222, 38104430, 38219302
Developmental Disabilities	Associate	31448840
Epilepsy Temporal Lobe	Associate	39377933
Focal cortical dysplasia of Taylor	Associate	34301297
Genetic Diseases Inborn	Associate	35012964, 8659540
Genetic Predisposition to Disease	Associate	16778599
Glioblastoma	Associate	34516348
Hereditary Central Nervous System Demyelinating Diseases	Associate	2479017
Heredodegenerative Disorders Nervous System	Associate	31448840, 36368327
Hippocampal Sclerosis	Associate	19562355
Hypersensitivity Delayed	Associate	27506666
Intellectual Disability	Associate	27506666, 31448840
Leukodystrophy Metachromatic	Associate	1376966, 14681886
Leukoencephalopathies	Associate	17962415, 20637281, 27179222, 36622199, 8786077
Lung Diseases Interstitial	Associate	23897225
Mental Disorders	Associate	31448840
Mitochondrial Diseases	Associate	34506833
Multiple Sclerosis	Associate	12355425, 15120759, 27917626, 9278634
Neoplasms	Associate	24236209, 28427185, 39812346
Nerve Degeneration	Associate	19562355
Oligodendroglioma	Associate	24236209
Opitz Kaveggia syndrome	Associate	31951325
Paraparesis Spastic	Associate	27179222
Parkinson Disease	Associate	37947401
Parkinson Disease Secondary	Associate	19875103
Pelizaeus Merzbacher Disease	Associate	10588103, 12297985, 13679292, 1376966, 1384324, 16380909, 16778599, 1720927, 17962415, 18160035, 18437021, 18571143, 19376225, 19562355, 19825935 View all (37 more)
Pelizaeus Merzbacher like disease autosomal recessive 2	Associate	24019930, 35748297
Peripheral Nervous System Diseases	Associate	14681886, 21679407, 27179222
Polyradiculoneuropathy	Associate	9247276
Prostatic Neoplasms	Associate	39812346
Quadriplegia	Associate	18437021
Restless Legs Syndrome	Associate	21570342
Schizophrenia	Associate	19875103
Spastic paraplegia 2 X linked	Associate	19376225, 8320699
Spastic Paraplegia Hereditary	Associate	16778599, 19376225, 21679407, 31448840, 36622199, 37475517, 8320699
ST Elevation Myocardial Infarction	Associate	34360827
Tremor	Associate	36622199
Urinary Bladder Neoplasms	Associate	38307969

PLP1 (proteolipid protein 1)