Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5351
Gene name Gene Name - the full gene name approved by the HGNC.
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLOD1
Synonyms (NCBI Gene) Gene synonyms aliases
EDS6, EDSKCL1, LH, LH1, LLH, PLOD
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.
Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysy
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs112460511 G>C,T Likely-pathogenic Splice acceptor variant
rs121913550 C>T Pathogenic Stop gained, coding sequence variant
rs121913551 G>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs121913552 C>G Pathogenic Stop gained, coding sequence variant
rs121913553 G>A,C Pathogenic Stop gained, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022239 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT024504 hsa-miR-215-5p Microarray 19074876
MIRT026202 hsa-miR-192-5p Microarray 19074876
MIRT052618 hsa-let-7a-5p CLASH 23622248
MIRT046301 hsa-miR-23b-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
PITX2 Unknown 21837767
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IEP 15174142
GO:0005506 Function Iron ion binding IEA
GO:0005515 Function Protein binding IPI 26496610, 28514442, 33961781
GO:0005615 Component Extracellular space IBA
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
153454 9081 ENSG00000083444
Protein
UniProt ID Q02809
Protein name Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (EC 1.14.11.4) (Lysyl hydroxylase 1) (LH1)
Protein function Part of a complex composed of PLOD1, P3H3 and P3H4 that catalyzes hydroxylation of lysine residues in collagen alpha chains and is required for normal assembly and cross-linkling of collagen fibrils (By similarity). Forms hydroxylysine residues
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03171 2OG-FeII_Oxy 637 727 2OG-Fe(II) oxygenase superfamily Domain
Sequence
MRPLLLLALLGWLLLAEAKGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGL
GEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELLKKFRQA
RSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQ
LFYTKIFLDPEKREQINITLDHRCRIFQNLDGALDEVVLKFEMGHVRARNLAYDTLPVLI
HGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEGLRSLKGIGDEALPTVLVGVFIEQPTPF
VSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANAD
ARNMGADLCRQDRSCTYYFSVDADVALTEPNSLRLLIQQNKNVIAPLMTRHGRLWSNFWG
ALSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLIKGSALRGELQSSDLFHHSKLDPD
MAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYT
KALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTID
IHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDAS
TFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYI
AVSFVDP
Sequence length 727
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Lysine degradation
Metabolic pathways
  Collagen biosynthesis and modifying enzymes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ehlers-Danlos Syndrome ehlers-danlos syndrome rs121913550, rs1439043436, rs121913552 N/A
Kyphoscoliotic Ehlers-Danlos Syndrome Ehlers-Danlos syndrome, kyphoscoliotic type 1 rs121913554, rs1433428588, rs121913550, rs745409628, rs1401035675, rs121913551, rs1224538282, rs797044446, rs565513365, rs1557500194, rs797044447, rs886042976, rs1569713366, rs121913552, rs886043926
View all (9 more)
N/A
Thoracic Aortic Aneurysm And Aortic Dissection familial thoracic aortic aneurysm and aortic dissection rs745409628, rs1401035675, rs565513365, rs121913552, rs1433428588 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Keratoconus keratoconus N/A N/A ClinVar
Moyamoya Disease Moyamoya disease N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Aneurysm Familial Thoracic 1 Associate 34400365
Bicuspid Aortic Valve Disease Associate 23525417
Bone Fragility with Contractures Arterial Rupture and Deafness Inhibit 21699693
Bone Fragility with Contractures Arterial Rupture and Deafness Associate 25277362, 33129265
Bruck syndrome 1 Associate 30721533
Carcinoma Renal Cell Associate 31446433, 33287763
Cicatrix Associate 32174067
Disease Associate 30721533
Ehlers Danlos Syndrome Associate 25277362, 29982180, 31063316
Ehlers Danlos syndrome type 6 Associate 11286629, 15854030, 21699693, 25277362, 28667723, 29982180, 31063316, 31288483, 32174067, 33129265, 33579342, 8981946