Gene Gene information from NCBI Gene database.
Entrez ID 5349
Gene name FXYD domain containing ion transport regulator 3
Gene symbol FXYD3
Synonyms (NCBI Gene)
MAT8PLML
Chromosome 19
Chromosome location 19q13.12
Summary This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene e
miRNA miRNA information provided by mirtarbase database.
61
miRTarBase ID miRNA Experiments Reference
MIRT1007449 hsa-miR-103b CLIP-seq
MIRT1007450 hsa-miR-1225-5p CLIP-seq
MIRT1007451 hsa-miR-1289 CLIP-seq
MIRT1007452 hsa-miR-1909 CLIP-seq
MIRT1007453 hsa-miR-193a-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0005254 Function Chloride channel activity TAS 7836447
GO:0005515 Function Protein binding IPI 32296183
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 7836447
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604996 4027 ENSG00000089356
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14802
Protein name FXYD domain-containing ion transport regulator 3 (Chloride conductance inducer protein Mat-8) (Mammary tumor 8 kDa protein) (Phospholemman-like) (Sodium/potassium-transporting ATPase subunit FXYD3)
Protein function Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell (PubMed:17077088). Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus revers
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02038 ATP1G1_PLM_MAT8 25 71 ATP1G1/PLM/MAT8 family Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1: Expressed mainly in differentiated cells (at protein level). Isoform 2: Expressed mainly in undifferentiated cells (at protein level). {ECO:0000269|PubMed:17077088}.
Sequence
MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAK
CKCKFGQKSGH
HPGETPPLITPGSAQS
Sequence length 87
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ion homeostasis
Ion transport by P-type ATPases