Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5349
Gene name Gene Name - the full gene name approved by the HGNC.	FXYD domain containing ion transport regulator 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FXYD3
Synonyms (NCBI Gene) Gene synonyms aliases	MAT8, PLML
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene e

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments
MIRT1007449	hsa-miR-103b	CLIP-seq
MIRT1007450	hsa-miR-1225-5p	CLIP-seq
MIRT1007451	hsa-miR-1289	CLIP-seq
MIRT1007452	hsa-miR-1909	CLIP-seq
MIRT1007453	hsa-miR-193a-5p	CLIP-seq
MIRT1007454	hsa-miR-224	CLIP-seq
MIRT1007455	hsa-miR-2467-3p	CLIP-seq
MIRT1007456	hsa-miR-3074-5p	CLIP-seq
MIRT1007457	hsa-miR-3120-5p	CLIP-seq
MIRT1007458	hsa-miR-3184	CLIP-seq
MIRT1007459	hsa-miR-340	CLIP-seq
MIRT1007460	hsa-miR-3940-5p	CLIP-seq
MIRT1007461	hsa-miR-423-5p	CLIP-seq
MIRT1007462	hsa-miR-4265	CLIP-seq
MIRT1007463	hsa-miR-4296	CLIP-seq
MIRT1007464	hsa-miR-4322	CLIP-seq
MIRT1007465	hsa-miR-4327	CLIP-seq
MIRT1007466	hsa-miR-4328	CLIP-seq
MIRT1007467	hsa-miR-4477a	CLIP-seq
MIRT1007468	hsa-miR-4507	CLIP-seq
MIRT1007469	hsa-miR-4530	CLIP-seq
MIRT1007470	hsa-miR-4539	CLIP-seq
MIRT1007471	hsa-miR-4753-3p	CLIP-seq
MIRT1007472	hsa-miR-4781-5p	CLIP-seq
MIRT1007473	hsa-miR-518a-5p	CLIP-seq
MIRT1007474	hsa-miR-527	CLIP-seq
MIRT1007475	hsa-miR-548g	CLIP-seq
MIRT1007476	hsa-miR-922	CLIP-seq
MIRT1007477	hsa-miR-944	CLIP-seq
MIRT1007478	hsa-miR-1206	CLIP-seq
MIRT1007479	hsa-miR-1229	CLIP-seq
MIRT1007453	hsa-miR-193a-5p	CLIP-seq
MIRT1007480	hsa-miR-2110	CLIP-seq
MIRT1007481	hsa-miR-3145-3p	CLIP-seq
MIRT1007482	hsa-miR-3150a-3p	CLIP-seq
MIRT1007483	hsa-miR-3150b-3p	CLIP-seq
MIRT1007484	hsa-miR-3175	CLIP-seq
MIRT1007485	hsa-miR-331-5p	CLIP-seq
MIRT1007486	hsa-miR-342-3p	CLIP-seq
MIRT1007460	hsa-miR-3940-5p	CLIP-seq
MIRT1007462	hsa-miR-4265	CLIP-seq
MIRT1007487	hsa-miR-4294	CLIP-seq
MIRT1007463	hsa-miR-4296	CLIP-seq
MIRT1007464	hsa-miR-4322	CLIP-seq
MIRT1007488	hsa-miR-4436a	CLIP-seq
MIRT1007489	hsa-miR-4443	CLIP-seq
MIRT1007468	hsa-miR-4507	CLIP-seq
MIRT1007490	hsa-miR-4678	CLIP-seq
MIRT1007471	hsa-miR-4753-3p	CLIP-seq
MIRT1007491	hsa-miR-4784	CLIP-seq
MIRT1007492	hsa-miR-532-5p	CLIP-seq
MIRT1007493	hsa-miR-765	CLIP-seq
MIRT1007494	hsa-miR-939	CLIP-seq
MIRT1998508	hsa-miR-4695-5p	CLIP-seq
MIRT2442174	hsa-miR-3119	CLIP-seq
MIRT1007462	hsa-miR-4265	CLIP-seq
MIRT1007463	hsa-miR-4296	CLIP-seq
MIRT1007464	hsa-miR-4322	CLIP-seq
MIRT2442175	hsa-miR-4417	CLIP-seq
MIRT2442176	hsa-miR-4446-5p	CLIP-seq
MIRT2442177	hsa-miR-4690-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	TAS	7836447
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7836447
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006821	Process	Chloride transport	TAS	7836447
GO:0016020	Component	Membrane	IEA
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0043269	Process	Regulation of monoatomic ion transport	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0099106	Function	Ion channel regulator activity	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IBA

MIM	HGNC	e!Ensembl
604996	4027	ENSG00000089356

Protein

UniProt ID

Q14802

Protein name

FXYD domain-containing ion transport regulator 3 (Chloride conductance inducer protein Mat-8) (Mammary tumor 8 kDa protein) (Phospholemman-like) (Sodium/potassium-transporting ATPase subunit FXYD3)

Protein function

Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell (PubMed:17077088). Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus revers

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02038	ATP1G1_PLM_MAT8	25 → 71	ATP1G1/PLM/MAT8 family	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1: Expressed mainly in differentiated cells (at protein level). Isoform 2: Expressed mainly in undifferentiated cells (at protein level). {ECO:0000269|PubMed:17077088}.

Sequence

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAK
CKCKFGQKSGHHPGETPPLITPGSAQS

Sequence length

Interactions

View interactions

	Reactome
			Ion homeostasis Ion transport by P-type ATPases

FXYD3 (FXYD domain containing ion transport regulator 3)