Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5347
Gene name Gene Name - the full gene name approved by the HGNC.	Polo like kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLK1
Synonyms (NCBI Gene) Gene synonyms aliases	PLK, STPK13
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p12.2
Summary Summary of gene provided in NCBI Entrez Gene.	The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cel

Show/Hide all(86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001430	hsa-miR-16-5p	pSILAC	18668040
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR	19739117
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT000382	hsa-miR-100-5p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21636267
MIRT020615	hsa-miR-155-5p	Proteomics	18668040
MIRT001430	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT051975	hsa-let-7b-5p	CLASH	23622248
MIRT038920	hsa-miR-92a-1-5p	CLASH	23622248
MIRT037761	hsa-miR-874-3p	CLASH	23622248
MIRT037217	hsa-miR-877-5p	CLASH	23622248
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	23151088
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT053537	hsa-miR-10b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23125021
MIRT000382	hsa-miR-100-5p	Western blot	22249248
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT733426	hsa-miR-122-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32700753
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2071781	hsa-miR-1203	CLIP-seq
MIRT2071782	hsa-miR-1913	CLIP-seq
MIRT2071783	hsa-miR-3194-3p	CLIP-seq
MIRT2071784	hsa-miR-324-3p	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071790	hsa-miR-4691-3p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq
MIRT2298932	hsa-miR-183	CLIP-seq
MIRT2298933	hsa-miR-2276	CLIP-seq
MIRT2298934	hsa-miR-3158-5p	CLIP-seq
MIRT2298935	hsa-miR-3166	CLIP-seq
MIRT2298936	hsa-miR-4418	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2298937	hsa-miR-4771	CLIP-seq
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2298938	hsa-miR-4789-5p	CLIP-seq
MIRT2298939	hsa-miR-509-5p	CLIP-seq
MIRT2298940	hsa-miR-541	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2298941	hsa-miR-654-5p	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
E2F1	Activation	24076372
E2F3	Unknown	16909110
E2F4	Repression	17981789
TP53	Unknown	24076372

Show/Hide all(88)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	23455478
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18174154
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	23509069
GO:0000278	Process	Mitotic cell cycle	IBA	21873635
GO:0000278	Process	Mitotic cell cycle	IDA	18615013
GO:0000278	Process	Mitotic cell cycle	IMP	18477460
GO:0000281	Process	Mitotic cytokinesis	IDA	19468302
GO:0000287	Function	Magnesium ion binding	IMP	17461553
GO:0000776	Component	Kinetochore	IDA	17617734, 18477460, 18615013, 21041660, 23455478, 24157919, 25395579
GO:0000785	Component	Chromatin	IEA
GO:0000795	Component	Synaptonemal complex	IEA
GO:0000922	Component	Spindle pole	IBA	21873635
GO:0000922	Component	Spindle pole	IDA	18331714, 21041660
GO:0000942	Component	Condensed nuclear chromosome outer kinetochore	IDA	18195732
GO:0001578	Process	Microtubule bundle formation	IDA	12939256
GO:0004672	Function	Protein kinase activity	IDA	17146433, 19596235, 22854038
GO:0004672	Function	Protein kinase activity	IMP	17461553
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	18378770, 20577264
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12524548, 12939256, 15148369, 17351640, 18174154, 18477460, 19160488, 19468300, 19468302, 23509069
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	19473992, 21041660, 23455478
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12493754, 12524548, 12939256, 15148369, 15654075, 16439210, 16753148, 16760428, 16815967, 16864798, 16980960, 17146433, 17307877, 17310276, 17351640, 17495026, 18174154, 18250300, 18329369, 18331714, 18477460, 18521620, 18615013, 18794143, 19160488, 19468300, 19468302, 19473992, 195
GO:0005524	Function	ATP binding	IMP	17461553
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	18615013
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	8991084, 12524548, 18477460, 18615013, 21041660, 21399614, 23455478, 24157919, 27579920
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IDA	12939256, 17351640
GO:0005829	Component	Cytosol	TAS
GO:0005876	Component	Spindle microtubule	IDA	21041660
GO:0006468	Process	Protein phosphorylation	IDA	19468300, 20679239, 22701722, 23509069
GO:0006468	Process	Protein phosphorylation	IMP	17461553
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007062	Process	Sister chromatid cohesion	TAS
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007094	Process	Mitotic spindle assembly checkpoint	IMP	23455478
GO:0007098	Process	Centrosome cycle	IMP	8991084, 18477460
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	17495026
GO:0008017	Function	Microtubule binding	IDA	12939256
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	21041660
GO:0010997	Function	Anaphase-promoting complex binding	IPI	18662541
GO:0015630	Component	Microtubule cytoskeleton	IDA	21041660
GO:0016301	Function	Kinase activity	TAS
GO:0016321	Process	Female meiosis chromosome segregation	IEA
GO:0016567	Process	Protein ubiquitination	IDA	16885022
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16885022
GO:0019901	Function	Protein kinase binding	IPI	12639966, 18615013, 21041660
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IDA	23509069
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IMP	21041660
GO:0030496	Component	Midbody	IDA	19468300
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031648	Process	Protein destabilization	IDA	16885022
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	19473992
GO:0032465	Process	Regulation of cytokinesis	IBA	21873635
GO:0032465	Process	Regulation of cytokinesis	IDA	17351640
GO:0032465	Process	Regulation of cytokinesis	IMP	12939256
GO:0034451	Component	Centriolar satellite	IEA
GO:0042802	Function	Identical protein binding	IPI	21041660, 23354166, 26192437
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18174154
GO:0043393	Process	Regulation of protein binding	IMP	21041660
GO:0045143	Process	Homologous chromosome segregation	IEA
GO:0045184	Process	Establishment of protein localization	IMP	18331714
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	21041660
GO:0045862	Process	Positive regulation of proteolysis	IDA	16885022
GO:0051081	Process	Nuclear envelope disassembly	IMP	20679239
GO:0051233	Component	Spindle midzone	IDA	19468302, 21041660
GO:0051443	Process	Positive regulation of ubiquitin-protein transferase activity	IMP	19473992
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0070194	Process	Synaptonemal complex disassembly	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	21111234
GO:0072425	Process	Signal transduction involved in G2 DNA damage checkpoint	IDA	18662541
GO:0090435	Process	Protein localization to nuclear envelope	IMP	20679239
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:1900182	Process	Positive regulation of protein localization to nucleus	TAS
GO:1901673	Process	Regulation of mitotic spindle assembly	IDA	22621898
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	TAS
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	IDA	15148369
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	TAS
GO:1904776	Process	Regulation of protein localization to cell cortex	IDA	23509069

MIM	HGNC	e!Ensembl
602098	9077	ENSG00000166851

Protein

UniProt ID

P53350

Protein name

Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13)

Protein function

Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivatio

PDB

1Q4K , 1Q4O , 1UMW , 2OGQ , 2OJX , 2OU7 , 2OWB , 2RKU , 2V5Q , 2YAC , 3BZI , 3C5L , 3FC2 , 3FVH , 3HIH , 3HIK , 3KB7 , 3P2W , 3P2Z , 3P34 , 3P35 , 3P36 , 3P37 , 3Q1I , 3RQ7 , 3THB , 4A4L , 4A4O , 4DFW , 4E67 , 4E9C , 4E9D , 4H5X , 4H71 , 4HAB , 4HCO , 4HY2 , 4J52 , 4J53 , 4LKL , 4LKM , 4O56 , 4O6W , 4O9W , 4RCP , 4WHH , 4WHK , 4WHL , 4X9R , 4X9V , 4X9W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	53 → 305	Protein kinase domain	Domain
PF00659	POLO_box	418 → 479	POLO box duplicated region	Family
PF00659	POLO_box	516 → 583	POLO box duplicated region	Family

Tissue specificity

TISSUE SPECIFICITY: Placenta and colon.

Sequence

MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS

Sequence length

603

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Oocyte meiosis Progesterone-mediated oocyte maturation		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Polo-like kinase mediated events Golgi Cisternae Pericentriolar Stack Reorganization APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Phosphorylation of the APC/C Phosphorylation of Emi1 Condensation of Prophase Chromosomes Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane RHO GTPases Activate Formins Mitotic Prometaphase Mitotic Metaphase/Anaphase Transition Mitotic Telophase/Cytokinesis Cyclin A/B1/B2 associated events during G2/M transition The role of GTSE1 in G2/M progression after G2 checkpoint AURKA Activation by TPX2 EML4 and NUDC in mitotic spindle formation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499 View all (13 more)	22000864
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	26008977
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)

Show/Hide Text Mining Associations (135)

Disease Name	Relationship Type	References
Associations from Text Mining
16p11.2 Deletion Syndrome	Associate	22828807
Abnormalities Drug Induced	Associate	25365521
Acrospiroma	Associate	18955447
Adenocarcinoma	Associate	23037713, 30747067
Adenocarcinoma of Lung	Associate	30760542, 32121037, 34039308, 34080290, 34397869, 34721732, 34880385, 34996932, 35325730, 35783192, 35941968, 38095634, 40191558
Adrenocortical Carcinoma	Associate	30413320, 32373071
Aneuploidy	Associate	22593191, 32286328
Anophthalmia with pulmonary hypoplasia	Associate	39358545
Bloom Syndrome	Associate	35119917
Bovine Respiratory Disease Complex	Associate	29653924, 30851646
Brain Ischemia	Associate	35436627
Breast Neoplasms	Associate	21352579, 21707964, 22309939, 22405092, 23506640, 23770244, 24324792, 24626184, 24835992, 24876664, 25505268, 27064522, 27368372, 27409838, 27558135 View all (18 more)
Bronchial Diseases	Stimulate	29997230
Burkitt Lymphoma	Associate	16160013, 32468878
Carcinogenesis	Associate	16630118, 19473992, 20089605, 26090465, 29246203, 33840043, 36068491
Carcinoma Basal Cell	Stimulate	19652546
Carcinoma Hepatocellular	Associate	19725153, 21480320, 26799423, 28648284, 29658607, 29728556, 29843122, 29843214, 30598500, 30705088, 32252611, 32275843, 32627011, 34522226, 34696748 View all (5 more)
Carcinoma Non Small Cell Lung	Associate	23151088, 31563561, 35871223, 37570823, 37899396
Carcinoma Ovarian Epithelial	Associate	22246341
Carcinoma Papillary	Associate	14735186
Carcinoma Renal Cell	Associate	23494182, 37033923
Carcinoma Squamous Cell	Stimulate	19652546
Carcinoma Squamous Cell	Associate	21602893, 30846478, 34080290, 36247089, 37185598, 37442189, 38272206
Cell Transformation Neoplastic	Associate	19473992
Cholangiocarcinoma	Associate	28648284, 28652654
Cholangiocarcinoma	Stimulate	30272356
Chromosomal Instability	Associate	27557495
Chromosome Aberrations	Associate	39684470
Ciliopathies	Associate	28614913
Colonic Neoplasms	Associate	16237758
Colorectal Neoplasms	Associate	12708489, 16052696, 16237758, 19098285, 20581060, 22648245, 24876664, 26047016, 26577686, 32096168, 32259417, 34735919, 35484177, 36267311
Congenital Abnormalities	Associate	35058575
COVID 19	Associate	33839760, 36389792, 37033923
Death	Associate	26047016
Developmental Disabilities	Associate	35058575
Diabetes Gestational	Associate	30474315
Diabetic Nephropathies	Associate	34557161
Diffuse Intrinsic Pontine Glioma	Associate	27538997
DNA Virus Infections	Associate	24532022
Drug Fever	Associate	25483079
Drug Related Side Effects and Adverse Reactions	Associate	19855194, 38072417
Drug Related Side Effects and Adverse Reactions	Inhibit	23574746
Drug Related Side Effects and Adverse Reactions	Stimulate	35941968
Endometrial Neoplasms	Associate	33859719
Endometriosis	Associate	18353325
Fibromyalgia	Associate	26015072
Glioblastoma	Associate	23047041, 27557495, 35256538, 37644431
Glioma	Associate	28178660, 29771424, 30133120, 30995921, 37872147
Glioma of Brain Familial	Associate	30133120
Graft vs Host Disease	Associate	39201599
Graves Ophthalmopathy	Associate	37272763
Hematologic Neoplasms	Associate	23753023, 34561554
Hereditary Breast and Ovarian Cancer Syndrome	Associate	27557495
Hodgkin Disease	Associate	37923249
Hyperplasia	Associate	31437238
Hypersensitivity Delayed	Associate	24026482
Hypothyroidism Congenital Nongoitrous 2	Stimulate	18353325
Idiopathic Pulmonary Fibrosis	Associate	24174361
Infections	Associate	37071125
Kidney Neoplasms	Associate	23494182
Laryngeal Neoplasms	Associate	21189159
Leukemia	Associate	19458358, 23753023, 23832765, 25574601, 26577686, 31122263, 38072417, 39684470
Leukemia Biphenotypic Acute	Associate	32060361
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	31122263
Leukemia Myeloid Acute	Associate	19458358, 25574601, 30480765, 37702821
Liposarcoma	Associate	21693658
Liver Neoplasms	Associate	34522226
Lung Diseases	Associate	32457348, 9094972
Lung Neoplasms	Associate	21293459, 23836654, 34080290, 35608130, 35871223, 36101745, 9094972
Lupus Erythematosus Systemic	Associate	36996699
Lymphatic Metastasis	Associate	22648245, 34967572
Lymphoma	Associate	15015605
Lymphoma B Cell Marginal Zone	Associate	28887496
Lymphoma Extranodal NK T Cell	Associate	38037110
Lymphoma Large B Cell Diffuse	Associate	30912195
Lymphoma T Cell	Associate	38037110
Malignant hyperthermia susceptibility type 3	Associate	38057271
Medulloblastoma	Associate	21652733, 22390279, 31541075, 34477871
Melanoma	Associate	19554017, 19652546, 21654832, 24884503, 33177155, 36768289
Mesothelioma	Associate	34580349
Mesothelioma Malignant	Associate	24327015, 27840913
Microcephaly	Associate	27906199, 35058575
Mosaic variegated aneuploidy syndrome	Associate	24026482, 35058575
Multiple Myeloma	Associate	23584897
Multiple Sclerosis	Associate	36232761
Muscle Neoplasms	Associate	34705620
Myelodysplastic Syndromes	Associate	37071125
Neoplasm Invasiveness	Stimulate	19725153
Neoplasm Invasiveness	Associate	33840043
Neoplasm Metastasis	Associate	21654832, 23775078, 29191835, 34154613
Neoplasm Metastasis	Stimulate	23494182
Neoplasm Metastasis	Inhibit	26577686
Neoplasms	Associate	14735186, 15160994, 15260889, 16052696, 16160013, 16237758, 16507989, 17233903, 18955447, 19458358, 19473992, 19554017, 19652546, 19855194, 20073508 View all (92 more)
Neoplasms	Stimulate	16630118, 19725153, 19775446, 22325354, 23037713, 23661607, 32121037, 34735919, 35838025
Nephronophthisis familial juvenile	Associate	22701722
Neuroblastoma	Associate	26046302
Neurodevelopmental Disorders	Associate	35058575
Neurofibrosarcoma	Associate	28556483, 37837931
Neuroleptic Malignant Syndrome	Associate	34561554
Oncogene Addiction	Associate	21292770
Oral Submucous Fibrosis	Associate	29652009
Osteoarthritis	Associate	36700234
Osteosarcoma	Associate	24566468, 27822032
Ovarian Neoplasms	Associate	14970859, 20073508, 21402713, 27557495, 29865033, 30851646, 32693821, 32886452, 35977930, 36142803
Pancreatic Neoplasms	Associate	18266952, 26090465, 26091808, 30933478, 33000197, 35773310
Pancreatic Neoplasms	Stimulate	22892842
Papillary Thyroid Microcarcinoma	Stimulate	14735186
Peripheral Arterial Disease	Associate	35436627
Personality Disorders	Associate	19554017
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	23753023
Prostatic Neoplasms	Associate	10660600, 22890325, 23661607, 24525428, 27557495, 29233929, 32704044, 33197890, 34198380, 34497666, 35305591, 37916740, 39201599
Prostatic Neoplasms	Inhibit	22065906
Prostatic Neoplasms	Stimulate	25252916
Prostatic Neoplasms Castration Resistant	Associate	25252916, 37949681
Prostatitis	Associate	34735919
Psoriasis	Associate	33416099
Pulmonary Arterial Hypertension	Associate	31437238
Rectal Neoplasms	Associate	20581060, 26047016
Retinoblastoma	Associate	34901994
Sarcoma	Associate	36435816
Skin Neoplasms	Associate	19652546, 38410032
Small Cell Lung Carcinoma	Associate	25198282, 26772203, 34397869
Spinal Cord Injuries	Associate	31783707
Squamous Cell Carcinoma of Head and Neck	Associate	29652009, 34663837, 35756492, 37452322, 38536443
Status Asthmaticus	Associate	34705620
Stomach Neoplasms	Associate	16440413, 16630118, 26576650, 28430578, 29393385, 37265030
Sveinsson Chorioretinal Atrophy	Associate	36627281
Thrombosis	Associate	29843122
Thyroid Cancer Papillary	Associate	30915753, 35838025
Thyroiditis Chronic	Associate	15015605
Triple Negative Breast Neoplasms	Associate	22309939, 22405092, 30108112, 34967572, 36008466, 36627281, 40300663
Urinary Bladder Neoplasms	Associate	29246203, 36181054, 39456780
Uterine Cervical Neoplasms	Associate	19775446, 20622363
Uterine Diseases	Associate	18353325
Uveal melanoma	Associate	32602935

PLK1 (polo like kinase 1)