Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5341
Gene name Gene Name - the full gene name approved by the HGNC.	Pleckstrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLEK
Synonyms (NCBI Gene) Gene synonyms aliases	P47, PLEK1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p14

Show/Hide all(91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT532353	hsa-miR-3923	PAR-CLIP	22012620
MIRT532352	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT532351	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT532350	hsa-miR-5696	PAR-CLIP	22012620
MIRT532349	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT532348	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT532347	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532346	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532345	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT532344	hsa-miR-4452	PAR-CLIP	22012620
MIRT532343	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT532342	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT532341	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532340	hsa-miR-4659b-3p	PAR-CLIP	22012620
MIRT532353	hsa-miR-3923	PAR-CLIP	22012620
MIRT532352	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT532351	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT532350	hsa-miR-5696	PAR-CLIP	22012620
MIRT532349	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT532348	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT532347	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532346	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532345	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT532344	hsa-miR-4452	PAR-CLIP	22012620
MIRT532343	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT532342	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT532341	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532340	hsa-miR-4659b-3p	PAR-CLIP	22012620
MIRT1240704	hsa-miR-1229	CLIP-seq
MIRT1240705	hsa-miR-1343	CLIP-seq
MIRT1240706	hsa-miR-148a	CLIP-seq
MIRT1240707	hsa-miR-148b	CLIP-seq
MIRT1240708	hsa-miR-152	CLIP-seq
MIRT1240709	hsa-miR-3074-5p	CLIP-seq
MIRT1240710	hsa-miR-3124-3p	CLIP-seq
MIRT1240711	hsa-miR-3613-5p	CLIP-seq
MIRT1240712	hsa-miR-3690	CLIP-seq
MIRT1240713	hsa-miR-4254	CLIP-seq
MIRT1240714	hsa-miR-4493	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT1240716	hsa-miR-4699-5p	CLIP-seq
MIRT1240717	hsa-miR-4709-3p	CLIP-seq
MIRT1240718	hsa-miR-4753-5p	CLIP-seq
MIRT1240719	hsa-miR-4757-5p	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT1240721	hsa-miR-582-5p	CLIP-seq
MIRT1240722	hsa-miR-600	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT2070770	hsa-miR-4506	CLIP-seq
MIRT2297937	hsa-miR-1323	CLIP-seq
MIRT2297938	hsa-miR-2467-5p	CLIP-seq
MIRT2297939	hsa-miR-3188	CLIP-seq
MIRT2297940	hsa-miR-3975	CLIP-seq
MIRT2297941	hsa-miR-4649-3p	CLIP-seq
MIRT2297942	hsa-miR-485-5p	CLIP-seq
MIRT2297943	hsa-miR-539	CLIP-seq
MIRT2297944	hsa-miR-548o	CLIP-seq
MIRT2297945	hsa-miR-558	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT2456632	hsa-miR-4330	CLIP-seq
MIRT2456633	hsa-miR-4749-3p	CLIP-seq
MIRT2595395	hsa-miR-1226	CLIP-seq
MIRT2595396	hsa-miR-197	CLIP-seq
MIRT2595397	hsa-miR-2682	CLIP-seq
MIRT2456632	hsa-miR-4330	CLIP-seq
MIRT2595398	hsa-miR-449c	CLIP-seq
MIRT2595399	hsa-miR-4514	CLIP-seq
MIRT2595400	hsa-miR-4645-5p	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT2595401	hsa-miR-4673	CLIP-seq
MIRT2595402	hsa-miR-4692	CLIP-seq
MIRT2595403	hsa-miR-4733-3p	CLIP-seq
MIRT2456633	hsa-miR-4749-3p	CLIP-seq
MIRT2595395	hsa-miR-1226	CLIP-seq
MIRT2688060	hsa-miR-146a	CLIP-seq
MIRT2688061	hsa-miR-146b-5p	CLIP-seq
MIRT2595396	hsa-miR-197	CLIP-seq
MIRT2595397	hsa-miR-2682	CLIP-seq
MIRT2688062	hsa-miR-4434	CLIP-seq
MIRT2595398	hsa-miR-449c	CLIP-seq
MIRT2595399	hsa-miR-4514	CLIP-seq
MIRT2688063	hsa-miR-4516	CLIP-seq
MIRT2688064	hsa-miR-4531	CLIP-seq
MIRT2595400	hsa-miR-4645-5p	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT2595401	hsa-miR-4673	CLIP-seq
MIRT2595402	hsa-miR-4692	CLIP-seq
MIRT1240716	hsa-miR-4699-5p	CLIP-seq
MIRT2595403	hsa-miR-4733-3p	CLIP-seq
MIRT2688065	hsa-miR-642a	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEP	2768345
GO:0002576	Process	Platelet degranulation	IDA	7559487
GO:0002576	Process	Platelet degranulation	IEA
GO:0005080	Function	Protein kinase C binding	IDA	8615792
GO:0005515	Function	Protein binding	IPI	8999861, 19722192, 28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	8694752, 9060471
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006904	Process	Vesicle docking involved in exocytosis	IEA
GO:0006904	Process	Vesicle docking involved in exocytosis	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	10995449
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010572	Process	Positive regulation of platelet activation	ISS
GO:0010920	Process	Negative regulation of inositol phosphate biosynthetic process	IDA	7782310
GO:0016020	Component	Membrane	HDA	19946888
GO:0019211	Function	Phosphatase activator activity	IDA	8999861
GO:0030030	Process	Cell projection organization	IDA	9060471
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IDA	10497244
GO:0030836	Process	Positive regulation of actin filament depolymerization	IDA	10497244
GO:0030836	Process	Positive regulation of actin filament depolymerization	IEA
GO:0030845	Process	Phospholipase C-inhibiting G protein-coupled receptor signaling pathway	IDA	7782310
GO:0030866	Process	Cortical actin cytoskeleton organization	IDA	10497244
GO:0031529	Process	Ruffle organization	IDA	10497244
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IDA	10497244
GO:0032587	Component	Ruffle membrane	IDA	9060471
GO:0033625	Process	Positive regulation of integrin activation	IEA
GO:0033625	Process	Positive regulation of integrin activation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	8694752
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	15698571
GO:0043647	Process	Inositol phosphate metabolic process	IDA	8999861
GO:0044089	Process	Positive regulation of cellular component biogenesis	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	7782310
GO:0050849	Process	Negative regulation of calcium-mediated signaling	NAS	8999861
GO:0060305	Process	Regulation of cell diameter	IDA	10995449
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	7782310
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	7559487
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0070527	Process	Platelet aggregation	IEA
GO:0070527	Process	Platelet aggregation	ISS
GO:0070560	Process	Protein secretion by platelet	IEA
GO:0070560	Process	Protein secretion by platelet	ISS

MIM	HGNC	e!Ensembl
173570	9070	ENSG00000115956

Protein

UniProt ID

P08567

Protein name

Pleckstrin (Platelet 47 kDa protein) (p47)

Protein function

Major protein kinase C substrate of platelets.

PDB

1PLS , 1W4M , 1X05 , 1XX0 , 1ZM0 , 2CSO , 2I5C , 2I5F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	5 → 101	PH domain	Domain
PF00610	DEP	139 → 219	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF00169	PH	245 → 347	PH domain	Domain

Sequence

MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV
ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK

Sequence length

350

Interactions

View interactions

	Reactome
			Platelet degranulation

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Celiac disease	Celiac disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anemia Sickle Cell	Associate	17654682
Anemia Sickle Cell	Stimulate	22982429
Arthritis Rheumatoid	Stimulate	26686060, 35087525
Arthrogryposis	Associate	26752647
Asthma	Associate	33602227
Atrial Fibrillation	Associate	36653368
Autoimmune Diseases	Associate	34539672
Blood Coagulation Disorders Inherited	Associate	8781424
Blood Platelet Disorders	Associate	8781424
Carcinogenesis	Associate	22179719
Carcinoma Non Small Cell Lung	Associate	36969247
Carcinoma Renal Cell	Associate	36854280
Cardiovascular Diseases	Stimulate	26686060, 35087525
Carotid Artery Diseases	Associate	37861500
Celiac Disease	Associate	27015091
Chronic Disease	Associate	26686060
Chronic Periodontitis	Stimulate	35087525
Colitis Ulcerative	Associate	22179719
Colitis Ulcerative	Stimulate	26686060
Colonic Neoplasms	Inhibit	12681507
Colorectal Neoplasms	Associate	12681507, 22179719, 24932611
Deltaretrovirus Infections	Associate	30837480
Diabetes Mellitus	Associate	17579087
Drug Hypersensitivity	Associate	37861500
Frontotemporal Dementia	Associate	34539672
Granulomatous Disease Chronic	Associate	10452961, 10910929, 11684018, 11698128, 14688376, 21190454, 22311747, 23688784, 23826567, 9774399
Granulomatous Disease Chronic Autosomal Recessive Cytochrome B Positive Type I	Associate	10910929, 11698128
Hearing Loss	Associate	37595341
Hypertension	Associate	16532385
Inflammation	Associate	15051615, 22990857
Leukemia Lymphoma Adult T Cell	Associate	30837480
Li Fraumeni Syndrome	Associate	26578795
Mastocytosis Systemic	Associate	26686060
Meningitis Bacterial	Associate	28272793
Muscular Dystrophy Duchenne	Associate	34922439
Nasal Polyps	Associate	36466903
Neoplasms	Inhibit	12681507, 36969247
Neoplasms	Associate	26578795, 31040156
Parkinson Disease	Associate	35475466
Periodontitis	Associate	26334995, 26686060, 35087525
Polycystic Ovary Syndrome	Stimulate	22569241
Pre Eclampsia	Associate	36258174
Psoriasis	Stimulate	32947961
Retinal Vein Occlusion	Inhibit	37884951
Sleep Apnea Obstructive	Associate	23155414
Spinal Cord Injuries	Associate	33982670
Stomach Neoplasms	Associate	38425243
Urinary Bladder Neoplasms	Associate	25907251
Vascular Calcification	Associate	34922439
Venous Thromboembolism	Associate	31420334, 37537391
Williams Syndrome	Associate	16532385
X Linked Combined Immunodeficiency Diseases	Associate	8982277

PLEK (pleckstrin)