Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53407
Gene name	Syntaxin 18
Gene symbol	STX18
Synonyms (NCBI Gene)	Ufe1
Chromosome	4
Chromosome location	4p16.3-p16.2
Summary	This gene encodes a member of the syntaxin family of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs) which is part of a membrane tethering complex that includes other SNAREs and several peripheral membrane proteins, and is

Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022496	hsa-miR-124-3p	Microarray	18668037
MIRT1400576	hsa-miR-1324	CLIP-seq
MIRT1400577	hsa-miR-3121-5p	CLIP-seq
MIRT1400578	hsa-miR-3974	CLIP-seq
MIRT1400579	hsa-miR-4302	CLIP-seq
MIRT1400580	hsa-miR-4697-3p	CLIP-seq
MIRT1400581	hsa-miR-4711-3p	CLIP-seq
MIRT1400582	hsa-miR-4786-3p	CLIP-seq
MIRT2120136	hsa-miR-3689d	CLIP-seq
MIRT2120137	hsa-miR-370	CLIP-seq
MIRT2120138	hsa-miR-3714	CLIP-seq
MIRT2120139	hsa-miR-4480	CLIP-seq
MIRT2120140	hsa-miR-4749-3p	CLIP-seq
MIRT2440862	hsa-miR-1304	CLIP-seq
MIRT2120137	hsa-miR-370	CLIP-seq
MIRT2440863	hsa-miR-4278	CLIP-seq
MIRT2440864	hsa-miR-4283	CLIP-seq
MIRT2440865	hsa-miR-4688	CLIP-seq
MIRT2440866	hsa-miR-526b	CLIP-seq
MIRT2460747	hsa-miR-1185	CLIP-seq
MIRT2460748	hsa-miR-186	CLIP-seq
MIRT2460749	hsa-miR-19a	CLIP-seq
MIRT2460750	hsa-miR-19b	CLIP-seq
MIRT2460751	hsa-miR-3133	CLIP-seq
MIRT2460752	hsa-miR-3605-5p	CLIP-seq
MIRT2460753	hsa-miR-3664-5p	CLIP-seq
MIRT2460754	hsa-miR-3679-5p	CLIP-seq
MIRT2460755	hsa-miR-4639-3p	CLIP-seq
MIRT2635939	hsa-miR-125a-5p	CLIP-seq
MIRT2635940	hsa-miR-125b	CLIP-seq
MIRT2635941	hsa-miR-127-5p	CLIP-seq
MIRT2440862	hsa-miR-1304	CLIP-seq
MIRT1400576	hsa-miR-1324	CLIP-seq
MIRT2635942	hsa-miR-2115	CLIP-seq
MIRT2635943	hsa-miR-299-3p	CLIP-seq
MIRT2635944	hsa-miR-3178	CLIP-seq
MIRT2120137	hsa-miR-370	CLIP-seq
MIRT2635945	hsa-miR-4261	CLIP-seq
MIRT2635946	hsa-miR-4265	CLIP-seq
MIRT2440863	hsa-miR-4278	CLIP-seq
MIRT2440864	hsa-miR-4283	CLIP-seq
MIRT2635947	hsa-miR-4296	CLIP-seq
MIRT2635948	hsa-miR-4319	CLIP-seq
MIRT2635949	hsa-miR-4322	CLIP-seq
MIRT2635950	hsa-miR-4417	CLIP-seq
MIRT2635951	hsa-miR-4457	CLIP-seq
MIRT2635952	hsa-miR-4477a	CLIP-seq
MIRT2635953	hsa-miR-4496	CLIP-seq
MIRT2635954	hsa-miR-4641	CLIP-seq
MIRT2440865	hsa-miR-4688	CLIP-seq
MIRT2635955	hsa-miR-4732-3p	CLIP-seq
MIRT2120140	hsa-miR-4749-3p	CLIP-seq
MIRT1400582	hsa-miR-4786-3p	CLIP-seq
MIRT2635956	hsa-miR-516a-3p	CLIP-seq
MIRT2440866	hsa-miR-526b	CLIP-seq
MIRT2635957	hsa-miR-579	CLIP-seq
MIRT2635958	hsa-miR-653	CLIP-seq
MIRT2635959	hsa-miR-670	CLIP-seq
MIRT2440862	hsa-miR-1304	CLIP-seq
MIRT1400576	hsa-miR-1324	CLIP-seq
MIRT2692349	hsa-miR-1976	CLIP-seq
MIRT2692350	hsa-miR-34b	CLIP-seq
MIRT2120137	hsa-miR-370	CLIP-seq
MIRT2120138	hsa-miR-3714	CLIP-seq
MIRT2635945	hsa-miR-4261	CLIP-seq
MIRT2440863	hsa-miR-4278	CLIP-seq
MIRT2440864	hsa-miR-4283	CLIP-seq
MIRT2635951	hsa-miR-4457	CLIP-seq
MIRT2635952	hsa-miR-4477a	CLIP-seq
MIRT2120139	hsa-miR-4480	CLIP-seq
MIRT2635953	hsa-miR-4496	CLIP-seq
MIRT2440865	hsa-miR-4688	CLIP-seq
MIRT2120140	hsa-miR-4749-3p	CLIP-seq
MIRT1400582	hsa-miR-4786-3p	CLIP-seq
MIRT2692351	hsa-miR-483-3p	CLIP-seq
MIRT2440866	hsa-miR-526b	CLIP-seq
MIRT2635957	hsa-miR-579	CLIP-seq
MIRT2692352	hsa-miR-622	CLIP-seq
MIRT2692353	hsa-miR-646	CLIP-seq
MIRT2635958	hsa-miR-653	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005484	Function	SNAP receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15029241, 15272311, 19369418, 28514442, 33961781, 35271311
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	10788491
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0061025	Process	Membrane fusion	IEA
GO:0090158	Process	Endoplasmic reticulum membrane organization	IMP	19401338
GO:1902117	Process	Positive regulation of organelle assembly	IMP	19401338
GO:1902953	Process	Positive regulation of ER to Golgi vesicle-mediated transport	IMP	10788491, 19401338
GO:1903358	Process	Regulation of Golgi organization	IMP	19401338

MIM	HGNC	e!Ensembl
606046	15942	ENSG00000168818

Q9P2W9

Protein name

Syntaxin-18 (Cell growth-inhibiting gene 9 protein)

Protein function

Syntaxin that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10496	Syntaxin-18_N	3 → 96	SNARE-complex protein Syntaxin-18 N-terminus	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	SNARE interactions in vesicular transport Phagosome		COPI-dependent Golgi-to-ER retrograde traffic

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Cognition Disorders	Associate	35240980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Associate	31712678	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	35668077	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35668077	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35668077	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Associate	35240980	★★★★★ ★☆☆☆☆ Found in Text Mining only

STX18 (syntaxin 18)