PLG (plasminogen)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5340
Gene name Plasminogen
Gene symbol PLG
Synonyms (NCBI Gene)
HAE4
Chromosome 6
Chromosome location 6q26
Summary The plasminogen protein encoded by this gene is a serine protease that circulates in blood plasma as an inactive zymogen and is converted to the active protease, plasmin, by several plasminogen activators such as tissue plasminogen activator (tPA), urokin
SNPs SNP information provided by dbSNP.
13
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (13)
SNP ID Visualize variation Clinical significance Consequence
rs73015965 A>G Benign, pathogenic, pathogenic-likely-pathogenic Coding sequence variant, missense variant
rs121918027 G>A Conflicting-interpretations-of-pathogenicity, pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918028 G>T Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918029 T>C Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918030 G>A Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
34
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (34)
miRTarBase ID miRNA Experiments Reference
MIRT1242627 hsa-miR-1301 CLIP-seq
MIRT1242628 hsa-miR-181a CLIP-seq
MIRT1242629 hsa-miR-181b CLIP-seq
MIRT1242630 hsa-miR-181c CLIP-seq
MIRT1242631 hsa-miR-181d CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
SRF Activation 15514113
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (63)
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IPI 7679575
GO:0004175 Function Endopeptidase activity IBA
GO:0004175 Function Endopeptidase activity IDA 7679575, 9603964
GO:0004252 Function Serine-type endopeptidase activity IDA 6447255, 14688145, 14699093, 17307854
GO:0004252 Function Serine-type endopeptidase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
173350 9071 ENSG00000122194
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P00747
Protein name Plasminogen (EC 3.4.21.7) [Cleaved into: Plasmin heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B]
Protein function Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian fo
PDB 1B2I , 1BML , 1BUI , 1CEA , 1CEB , 1DDJ , 1HPJ , 1HPK , 1I5K , 1KI0 , 1KRN , 1L4D , 1L4Z , 1PK4 , 1PKR , 1PMK , 1QRZ , 1RJX , 2DOH , 2DOI , 2KNF , 2L0S , 2PK4 , 3UIR , 4A5T , 4CIK , 4DCB , 4DUR , 4DUU , 5HPG , 5UGD , 5UGG , 6D3X , 6D3Y , 6D3Z , 6D40 , 6OG4 , 6OQJ , 6OQK , 6Q1U , 6UZ4 , 6UZ5 , 7E50 , 7THS , 7UAH , 8F7U , 8F7V , 8UQ6 , 9AZK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00024 PAN_1 23 → 99 PAN domain Domain
PF00051 Kringle 103 → 181 Kringle domain Domain
PF00051 Kringle 185 → 262 Kringle domain Domain
PF00051 Kringle 275 → 352 Kringle domain Domain
PF00051 Kringle 377 → 454 Kringle domain Domain
PF00051 Kringle 481 → 560 Kringle domain Domain
PF00089 Trypsin 581 → 803 Trypsin Domain
Tissue specificity TISSUE SPECIFICITY: Present in plasma and many other extracellular fluids. It is synthesized in the liver.
Sequence 
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Sequence length 810
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Influenza A 		  Platelet degranulation
Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases
Signaling by PDGF
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Dissolution of Fibrin Clot
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
223
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (8)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Angioedema, hereditary, 4 Likely pathogenic; Pathogenic rs73015965, rs889957249, rs1582955358 RCV005042050
RCV001507288
RCV001507289
Deep venous thrombosis Likely pathogenic; Pathogenic rs73015965 RCV002221996
Dysplasminogenemia Pathogenic rs121918028, rs121918029 RCV000014543
RCV000014544
Hereditary angioedema with normal C1Inh Pathogenic rs1582955358 RCV001027412
Show/Hide Unknown Diseases (12)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormal bleeding Conflicting classifications of pathogenicity rs140537724 RCV001270566
Atypical hemolytic-uremic syndrome Uncertain significance rs138728014 RCV001328254
Cholangiocarcinoma Benign rs4252117 RCV005918879
Cystic fibrosis risk factor rs756287836 RCV000991135
Show/Hide Text Mining Associations (145)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acantholysis Associate 9347794
Adenoma Associate 9006343
Alzheimer Disease Associate 16828203, 22232349
Amyotrophic Lateral Sclerosis Associate 39278909
Angioedemas Hereditary Associate 30394658, 31771982, 32066472, 32578786, 33593719, 33799813, 36418094, 36787826, 37992228
Aortic Aneurysm Abdominal Associate 9013920
Aortic Aneurysm Familial Abdominal 1 Associate 10805895
Aortic Dissection Associate 9013920
Arterial Occlusive Diseases Stimulate 25069814
Arteriosclerosis Associate 9013920