Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	534
Gene name Gene Name - the full gene name approved by the HGNC.	ATPase H+ transporting V1 subunit G2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATP6V1G2
Synonyms (NCBI Gene) Gene synonyms aliases	ATP6G, ATP6G2, NG38, VMA10
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sor

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments
MIRT809507	hsa-miR-1264	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT809509	hsa-miR-3161	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT809512	hsa-miR-9	CLIP-seq
MIRT809507	hsa-miR-1264	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT1939151	hsa-miR-2110	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT1939154	hsa-miR-3150a-3p	CLIP-seq
MIRT1939155	hsa-miR-3153	CLIP-seq
MIRT809509	hsa-miR-3161	CLIP-seq
MIRT1939156	hsa-miR-34b	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT1939157	hsa-miR-4260	CLIP-seq
MIRT1939158	hsa-miR-4271	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT1939160	hsa-miR-4668-5p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT1939162	hsa-miR-4725-3p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT809512	hsa-miR-9	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT1939156	hsa-miR-34b	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT2482107	hsa-miR-127-5p	CLIP-seq
MIRT2482108	hsa-miR-2052	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT2482109	hsa-miR-2355-5p	CLIP-seq
MIRT2482110	hsa-miR-27a	CLIP-seq
MIRT2482111	hsa-miR-27b	CLIP-seq
MIRT2482112	hsa-miR-296-3p	CLIP-seq
MIRT2482113	hsa-miR-323-5p	CLIP-seq
MIRT2482114	hsa-miR-3665	CLIP-seq
MIRT2482115	hsa-miR-3685	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT2482116	hsa-miR-4261	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT2482117	hsa-miR-4464	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT2482118	hsa-miR-4748	CLIP-seq
MIRT2482119	hsa-miR-513a-3p	CLIP-seq
MIRT2482120	hsa-miR-513a-5p	CLIP-seq
MIRT2482121	hsa-miR-520d-5p	CLIP-seq
MIRT2482122	hsa-miR-524-5p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT2482123	hsa-miR-629	CLIP-seq
MIRT2482124	hsa-miR-633	CLIP-seq
MIRT2482125	hsa-miR-876-3p	CLIP-seq
MIRT2482107	hsa-miR-127-5p	CLIP-seq
MIRT2482108	hsa-miR-2052	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT2482112	hsa-miR-296-3p	CLIP-seq
MIRT2482113	hsa-miR-323-5p	CLIP-seq
MIRT2482114	hsa-miR-3665	CLIP-seq
MIRT2482116	hsa-miR-4261	CLIP-seq
MIRT2482117	hsa-miR-4464	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT2482118	hsa-miR-4748	CLIP-seq
MIRT2482120	hsa-miR-513a-5p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT2482124	hsa-miR-633	CLIP-seq
MIRT2482125	hsa-miR-876-3p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	TAS
GO:0008286	Process	Insulin receptor signaling pathway	TAS
GO:0016241	Process	Regulation of macroautophagy	NAS	22982048
GO:0016471	Component	Vacuolar proton-transporting V-type ATPase complex	IBA	21873635
GO:0033572	Process	Transferrin transport	TAS
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0042470	Component	Melanosome	IEA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IEA
GO:0090383	Process	Phagosome acidification	TAS
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
606853	862	ENSG00000213760

Protein

UniProt ID

O95670

Protein name

V-type proton ATPase subunit G 2 (V-ATPase subunit G 2) (V-ATPase 13 kDa subunit 2) (Vacuolar proton pump subunit G 2)

Protein function

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03179	V-ATPase_G	3 → 107	Vacuolar (H+)-ATPase G subunit	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Brain. {ECO:0000269|PubMed:12384298}.

Sequence

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Sequence length

118

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Phagosome mTOR signaling pathway Synaptic vesicle cycle Collecting duct acid secretion Vibrio cholerae infection Epithelial cell signaling in Helicobacter pylori infection Human papillomavirus infection Rheumatoid arthritis		ROS and RNS production in phagocytes Insulin receptor recycling Transferrin endocytosis and recycling Amino acids regulate mTORC1 Ion channel transport

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Myasthenia gravis	Myasthenia Gravis	rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913 View all (8 more)	26562150
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	19503088, 21156761

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Myositis	Myositis	GWAS
Dermatitis	Dermatitis	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Inhibit	40021385
Blood Platelet Disorders	Associate	26367242
Glioma	Associate	35266851, 35896732
Nerve Degeneration	Associate	40021385

ATP6V1G2 (ATPase H+ transporting V1 subunit G2)