Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	534
Gene name	ATPase H+ transporting V1 subunit G2
Gene symbol	ATP6V1G2
Synonyms (NCBI Gene)	ATP6GATP6G2NG38VMA10
Chromosome	6
Chromosome location	6p21.33
Summary	This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sor

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments
MIRT809507	hsa-miR-1264	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT809509	hsa-miR-3161	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT809512	hsa-miR-9	CLIP-seq
MIRT809507	hsa-miR-1264	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT1939151	hsa-miR-2110	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT1939154	hsa-miR-3150a-3p	CLIP-seq
MIRT1939155	hsa-miR-3153	CLIP-seq
MIRT809509	hsa-miR-3161	CLIP-seq
MIRT1939156	hsa-miR-34b	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT1939157	hsa-miR-4260	CLIP-seq
MIRT1939158	hsa-miR-4271	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT1939160	hsa-miR-4668-5p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT1939162	hsa-miR-4725-3p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT809512	hsa-miR-9	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT1939156	hsa-miR-34b	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT809508	hsa-miR-1265	CLIP-seq
MIRT2482107	hsa-miR-127-5p	CLIP-seq
MIRT2482108	hsa-miR-2052	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT2482109	hsa-miR-2355-5p	CLIP-seq
MIRT2482110	hsa-miR-27a	CLIP-seq
MIRT2482111	hsa-miR-27b	CLIP-seq
MIRT2482112	hsa-miR-296-3p	CLIP-seq
MIRT2482113	hsa-miR-323-5p	CLIP-seq
MIRT2482114	hsa-miR-3665	CLIP-seq
MIRT2482115	hsa-miR-3685	CLIP-seq
MIRT809510	hsa-miR-3692	CLIP-seq
MIRT2482116	hsa-miR-4261	CLIP-seq
MIRT809511	hsa-miR-4307	CLIP-seq
MIRT2482117	hsa-miR-4464	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT2482118	hsa-miR-4748	CLIP-seq
MIRT2482119	hsa-miR-513a-3p	CLIP-seq
MIRT2482120	hsa-miR-513a-5p	CLIP-seq
MIRT2482121	hsa-miR-520d-5p	CLIP-seq
MIRT2482122	hsa-miR-524-5p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT2482123	hsa-miR-629	CLIP-seq
MIRT2482124	hsa-miR-633	CLIP-seq
MIRT2482125	hsa-miR-876-3p	CLIP-seq
MIRT2482107	hsa-miR-127-5p	CLIP-seq
MIRT2482108	hsa-miR-2052	CLIP-seq
MIRT1939152	hsa-miR-221	CLIP-seq
MIRT1939153	hsa-miR-222	CLIP-seq
MIRT2482112	hsa-miR-296-3p	CLIP-seq
MIRT2482113	hsa-miR-323-5p	CLIP-seq
MIRT2482114	hsa-miR-3665	CLIP-seq
MIRT2482116	hsa-miR-4261	CLIP-seq
MIRT2482117	hsa-miR-4464	CLIP-seq
MIRT1939159	hsa-miR-4468	CLIP-seq
MIRT2178243	hsa-miR-4708-3p	CLIP-seq
MIRT1939161	hsa-miR-4724-5p	CLIP-seq
MIRT2482118	hsa-miR-4748	CLIP-seq
MIRT2482120	hsa-miR-513a-5p	CLIP-seq
MIRT1939163	hsa-miR-548v	CLIP-seq
MIRT2482124	hsa-miR-633	CLIP-seq
MIRT2482125	hsa-miR-876-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000221	Component	Vacuolar proton-transporting V-type ATPase, V1 domain	IBA
GO:0000221	Component	Vacuolar proton-transporting V-type ATPase, V1 domain	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016241	Process	Regulation of macroautophagy	NAS	22982048
GO:0016471	Component	Vacuolar proton-transporting V-type ATPase complex	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042470	Component	Melanosome	IEA
GO:0046961	Function	Proton-transporting ATPase activity, rotational mechanism	IBA
GO:0046961	Function	Proton-transporting ATPase activity, rotational mechanism	IEA
GO:0097401	Process	Synaptic vesicle lumen acidification	IBA
GO:0097401	Process	Synaptic vesicle lumen acidification	IEA
GO:0098850	Component	Extrinsic component of synaptic vesicle membrane	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
606853	862	ENSG00000213760

O95670

Protein name

V-type proton ATPase subunit G 2 (V-ATPase subunit G 2) (V-ATPase 13 kDa subunit 2) (Vacuolar proton pump subunit G 2)

Protein function

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03179	V-ATPase_G	3 → 107	Vacuolar (H+)-ATPase G subunit	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Brain. {ECO:0000269|PubMed:12384298}.

Sequence

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Sequence length

118

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Phagosome mTOR signaling pathway Synaptic vesicle cycle Collecting duct acid secretion Vibrio cholerae infection Epithelial cell signaling in Helicobacter pylori infection Human papillomavirus infection Rheumatoid arthritis		ROS and RNS production in phagocytes Insulin receptor recycling Transferrin endocytosis and recycling Amino acids regulate mTORC1 Ion channel transport

ATP6V1G2 (ATPase H+ transporting V1 subunit G2)