Gene Gene information from NCBI Gene database.
Entrez ID 5335
Gene name Phospholipase C gamma 1
Gene symbol PLCG1
Synonyms (NCBI Gene)
IDAANCKAP3PLC-IIPLC1PLC148PLCgamma1
Chromosome 20
Chromosome location 20q12
Summary The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
miRNA miRNA information provided by mirtarbase database.
283
miRTarBase ID miRNA Experiments Reference
MIRT025369 hsa-miR-34a-5p Proteomics 21566225
MIRT025369 hsa-miR-34a-5p Proteomics 21566225
MIRT049488 hsa-miR-92a-3p CLASH 23622248
MIRT037381 hsa-miR-744-3p CLASH 23622248
MIRT035779 hsa-miR-1914-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0001726 Component Ruffle IDA 17229814
GO:0001726 Component Ruffle IEA
GO:0002862 Process Negative regulation of inflammatory response to antigenic stimulus TAS
GO:0004435 Function Phosphatidylinositol-4,5-bisphosphate phospholipase C activity IBA
GO:0004435 Function Phosphatidylinositol-4,5-bisphosphate phospholipase C activity IDA 2550068
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
172420 9065 ENSG00000124181
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19174
Protein name 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (EC 3.1.4.11) (PLC-148) (Phosphoinositide phospholipase C-gamma-1) (Phospholipase C-II) (PLC-II) (Phospholipase C-gamma-1) (PLC-gamma-1)
Protein function Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediate
PDB 1HSQ , 2HSP , 4EY0 , 4FBN , 7NXE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00388 PI-PLC-X 322 465 Phosphatidylinositol-specific phospholipase C, X domain Family
PF00017 SH2 550 639 SH2 domain Domain
PF00017 SH2 668 741 SH2 domain Domain
PF00018 SH3_1 797 843 SH3 domain Domain
PF00387 PI-PLC-Y 953 1068 Phosphatidylinositol-specific phospholipase C, Y domain Family
PF00168 C2 1088 1193 C2 domain Domain
Sequence
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKK
LAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHY
QQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYY
EKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPS
NYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPST
MRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLK
NNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
Sequence length 1290
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Inositol phosphate metabolism
Metabolic pathways
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Axon guidance
VEGF signaling pathway
Neutrophil extracellular trap formation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Parkinson disease
Pathways of neurodegeneration - multiple diseases
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Yersinia infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  ISG15 antiviral mechanism
Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
Synthesis of IP3 and IP4 in the cytosol
Downstream signal transduction
Generation of second messenger molecules
Role of phospholipids in phagocytosis
PECAM1 interactions
EGFR interacts with phospholipase C-gamma
DAP12 signaling
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
VEGFR2 mediated cell proliferation
Constitutive Signaling by EGFRvIII
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
Signaling by FGFR3 point mutants in cancer
RET signaling
Activated NTRK2 signals through PLCG1
Activated NTRK3 signals through PLCG1
FCGR3A-mediated IL10 synthesis
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Signaling by ERBB2 TMD/JMD mutants
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Immune dysregulation, autoimmunity, and autoinflammation Pathogenic rs2515585150 RCV003330117
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs761555687 RCV001374521
PLCG1-related disorder Uncertain significance rs2515561074, rs2515563874 RCV003894186
RCV003944548
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 25308733
Adenocarcinoma of Lung Associate 34869771, 35421944
Aortic Aneurysm Abdominal Associate 25993291
Arthritis Rheumatoid Associate 37008939
Ataxia Telangiectasia Associate 9083089
Blood Platelet Disorders Associate 31889510
Breast Neoplasms Associate 14710234, 23320987, 28112359, 31323325, 31362705
Calcinosis Cutis Associate 31362705
Carcinogenesis Associate 29049217, 31049933
Carcinoma Hepatocellular Associate 26290635, 35242200, 35535333, 36920176