UBASH3A (ubiquitin associated and SH3 domain containing A)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 53347
Gene name Ubiquitin associated and SH3 domain containing A
Gene symbol UBASH3A
Synonyms (NCBI Gene)
CLIP4STS-2TULATULA-1
Chromosome 21
Chromosome location 21q22.3
Summary This gene encodes one of two family members belonging to the T-cell ubiquitin ligand (TULA) family. Both family members can negatively regulate T-cell signaling. This family member can facilitate growth factor withdrawal-induced apoptosis in T cells, whic
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT2361048 hsa-miR-1207-3p CLIP-seq
MIRT2361049 hsa-miR-146b-3p CLIP-seq
MIRT2361050 hsa-miR-1914 CLIP-seq
MIRT2361051 hsa-miR-3173-5p CLIP-seq
MIRT2361052 hsa-miR-874 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production IEA
GO:0005515 Function Protein binding IPI 21516116, 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605736 12462 ENSG00000160185
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57075
Protein name Ubiquitin-associated and SH3 domain-containing protein A (Cbl-interacting protein 4) (CLIP4) (Suppressor of T-cell receptor signaling 2) (STS-2) (T-cell ubiquitin ligand 1) (TULA-1)
Protein function Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligible protein tyro
PDB 2CRN , 5WDI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14604 SH3_9 283 → 337 Variant SH3 domain Domain
PF00300 His_Phos_1 439 → 638 Histidine phosphatase superfamily (branch 1) Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow. {ECO:0000269|PubMed:11281453, ECO:0000269|PubMed:15107835}.
Sequence 
MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDH
CNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCE
DQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEA
SLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK
FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPG
DYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLN
SRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLVVRHGERVDQIFGKAWLQQCS
TPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA
SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNID
TDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLL
GLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISG
N
Sequence length 661
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Benign rs1893592 RCV005918058
Malignant lymphoma, large B-cell, diffuse Benign rs1893592 RCV005918059
UBASH3A-related disorder Likely benign rs139067853 RCV003894036
Show/Hide Text Mining Associations (14)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Islet Cell Associate 22315323, 22776074
Arthritis Rheumatoid Associate 24532676, 30822156, 32117312
Autoimmune Diseases Associate 23565265, 28607106, 29491471, 30822156, 31659016
Cakut Associate 34502088
Cholangitis Sclerosing Associate 27992413
Diabetes Mellitus Associate 22315323, 22776074, 25075402
Diabetes Mellitus Type 1 Associate 18647951, 18840781, 19732865, 21829393, 22315323, 22776074, 24367383, 25075402, 28607106, 29491471, 30910956, 31659016, 37240014
Graves Disease Associate 21829393
Lupus Erythematosus Systemic Associate 23565265
Negative rheumatoid factor polyarthritis Associate 30822156