Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	53340
Gene name	Sperm autoantigenic protein 17
Gene symbol	SPA17
Synonyms (NCBI Gene)	CT22SP17SP17-1
Chromosome	11
Chromosome location	11q24.2
Summary	This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central por

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720634	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT720635	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT720633	hsa-miR-3926	HITS-CLIP	19536157
MIRT720632	hsa-miR-548s	HITS-CLIP	19536157
MIRT708560	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT708559	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT708558	hsa-miR-6072	HITS-CLIP	19536157
MIRT708557	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT708556	hsa-miR-5193	HITS-CLIP	19536157
MIRT708555	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT708554	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT708553	hsa-miR-4674	HITS-CLIP	19536157
MIRT708552	hsa-miR-1587	HITS-CLIP	19536157
MIRT708551	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT708550	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708549	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT525989	hsa-miR-3154	PAR-CLIP	22012620
MIRT525988	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT525987	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT525986	hsa-miR-3668	PAR-CLIP	22012620
MIRT525985	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525984	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525983	hsa-miR-378b	PAR-CLIP	22012620
MIRT525982	hsa-miR-378c	PAR-CLIP	22012620
MIRT525981	hsa-miR-378d	PAR-CLIP	22012620
MIRT525980	hsa-miR-378e	PAR-CLIP	22012620
MIRT525979	hsa-miR-378f	PAR-CLIP	22012620
MIRT525978	hsa-miR-378h	PAR-CLIP	22012620
MIRT525977	hsa-miR-378i	PAR-CLIP	22012620
MIRT525976	hsa-miR-422a	PAR-CLIP	22012620
MIRT525975	hsa-miR-3171	PAR-CLIP	22012620
MIRT525974	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525973	hsa-miR-492	PAR-CLIP	22012620
MIRT525972	hsa-miR-659-5p	PAR-CLIP	22012620
MIRT525971	hsa-miR-3935	PAR-CLIP	22012620
MIRT525970	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT525969	hsa-miR-4535	PAR-CLIP	22012620
MIRT720634	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT720635	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT720633	hsa-miR-3926	HITS-CLIP	19536157
MIRT720632	hsa-miR-548s	HITS-CLIP	19536157
MIRT708560	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT708559	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT708558	hsa-miR-6072	HITS-CLIP	19536157
MIRT708557	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT708556	hsa-miR-5193	HITS-CLIP	19536157
MIRT708555	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT708554	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT708553	hsa-miR-4674	HITS-CLIP	19536157
MIRT708552	hsa-miR-1587	HITS-CLIP	19536157
MIRT708551	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT708550	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708549	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT525989	hsa-miR-3154	PAR-CLIP	22012620
MIRT525988	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT525987	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT525986	hsa-miR-3668	PAR-CLIP	22012620
MIRT525985	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525984	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525983	hsa-miR-378b	PAR-CLIP	22012620
MIRT525982	hsa-miR-378c	PAR-CLIP	22012620
MIRT525981	hsa-miR-378d	PAR-CLIP	22012620
MIRT525980	hsa-miR-378e	PAR-CLIP	22012620
MIRT525979	hsa-miR-378f	PAR-CLIP	22012620
MIRT525978	hsa-miR-378h	PAR-CLIP	22012620
MIRT525977	hsa-miR-378i	PAR-CLIP	22012620
MIRT525976	hsa-miR-422a	PAR-CLIP	22012620
MIRT525975	hsa-miR-3171	PAR-CLIP	22012620
MIRT525974	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525973	hsa-miR-492	PAR-CLIP	22012620
MIRT525972	hsa-miR-659-5p	PAR-CLIP	22012620
MIRT525971	hsa-miR-3935	PAR-CLIP	22012620
MIRT525970	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT525969	hsa-miR-4535	PAR-CLIP	22012620
MIRT1381639	hsa-miR-3976	CLIP-seq
MIRT1381640	hsa-miR-4709-5p	CLIP-seq
MIRT1381641	hsa-miR-5096	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq
MIRT1381643	hsa-miR-579	CLIP-seq
MIRT1381644	hsa-miR-664	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	NAS	18421703
GO:0005515	Function	Protein binding	IPI	15257753, 17551920, 25416956, 25910212, 28514442, 32296183, 33961781
GO:0005516	Function	Calmodulin binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18421703
GO:0005737	Component	Cytoplasm	IEA
GO:0005929	Component	Cilium	IDA	18421703
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	TAS	8688458
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	TAS	8688458
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IDA	18421703
GO:0035686	Component	Sperm fibrous sheath	IBA
GO:0035686	Component	Sperm fibrous sheath	IDA	19604394
GO:0035686	Component	Sperm fibrous sheath	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0097228	Component	Sperm principal piece	IBA
GO:0097228	Component	Sperm principal piece	IDA	15257753
GO:0097228	Component	Sperm principal piece	IEA

MIM	HGNC	e!Ensembl
608621	11210	ENSG00000064199

Q15506

Protein name

Sperm surface protein Sp17 (Cancer/testis antigen 22) (CT22) (Sp17-1) (Sperm autoantigenic protein 17) (Sperm protein 17)

Protein function

Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates (By similarity).

PDB

8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02197	RIIa	14 → 51	Regulatory subunit of type II PKA R-subunit	Domain
PF00612	IQ	115 → 135	IQ calmodulin-binding motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Testis and sperm specific.

Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
IQAAFRGHIAREEAKKMKTNSLQNEEKEENK

Sequence length

151

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acquired Hyperostosis Syndrome	Associate	33392854	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	12739786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	19744347	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	19685492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	23923079	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	24103781, 25739119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	19744347, 30309325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	37533202	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystadenoma Serous	Associate	30309325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Stimulate	27618037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Stimulate	19685492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	31336797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34913480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25739119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	11568003	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	20726502	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningeal Neoplasms	Associate	16438728	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	11222401, 12015770, 12130509, 15381930, 16438728	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11222401, 12015770, 12130509, 19685492, 20726502, 20885926, 23923079, 24103781, 25739119, 27618037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	30309325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	19685492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Associate	16438728	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Associate	16438728	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	19744347	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	12015770, 16438728	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Associate	24103781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Associate	27618037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Associate	33463119	★★★★★ ★☆☆☆☆ Found in Text Mining only

SPA17 (sperm autoantigenic protein 17)