PLAUR (plasminogen activator, urokinase receptor)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5329
Gene name Plasminogen activator, urokinase receptor
Gene symbol PLAUR
Synonyms (NCBI Gene)
CD87U-PARUPARURKR
Chromosome 19
Chromosome location 19q13.31
Summary This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized deg
miRNA miRNA information provided by mirtarbase database.
78
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (78)
miRTarBase ID miRNA Experiments Reference
MIRT005839 hsa-miR-204-5p Microarray 21282569
MIRT020661 hsa-miR-155-5p Proteomics 18668040
MIRT031606 hsa-miR-16-5p Proteomics 18668040
MIRT1239464 hsa-miR-1200 CLIP-seq
MIRT1239465 hsa-miR-1208 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
20
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (20)
Transcription factor Regulation Reference
ATF1 Unknown 12369939
EGR1 Activation 21283769
ETV4 Unknown 11234878
FOS Unknown 10471035
FOSL1 Unknown 10471035;11234878
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (43)
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IMP 22984561
GO:0005102 Function Signaling receptor binding IPI 12665524
GO:0005515 Function Protein binding IPI 11290596, 14764453, 15922359, 18376415, 18718938, 24457100, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
173391 9053 ENSG00000011422
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03405
Protein name Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)
Protein function Acts as a receptor for urokinase plasminogen activator (PubMed:15677461). Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-
PDB 1YWH , 2FD6 , 2I9B , 3BT1 , 3BT2 , 3U73 , 3U74 , 4K24 , 4QTI , 7E17 , 7V63
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 25 → 99 u-PAR/Ly-6 domain Domain
PF00021 UPAR_LY6 216 → 294 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
Sequence 
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Complement and coagulation cascades
Proteoglycans in cancer 		  Attachment of GPI anchor to uPAR
Neutrophil degranulation
Dissolution of Fibrin Clot
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (8)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Likely benign rs150986089 RCV005933329
Cervical cancer Likely benign rs150986089 RCV005933332
Clear cell carcinoma of kidney Likely benign rs150986089 RCV005933333
Colorectal cancer Likely benign rs150986089 RCV005933334
Show/Hide Text Mining Associations (159)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acantholysis Associate 9347794
Acute erythroleukemia Associate 15849776
Adenocarcinoma Associate 32048177
Adenocarcinoma of Lung Associate 22529186, 23287851, 29961070, 37795779, 37880277
Adenoma Associate 20496126, 9824607
Airway Obstruction Associate 23806081
Airway Remodeling Associate 22139533, 25041788, 26869673
Ameloblastoma Associate 36507758
Angioedemas Hereditary Stimulate 29729940
Arthritis Associate 8646430, 9215148