Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5329
Gene name Gene Name - the full gene name approved by the HGNC.
Plasminogen activator, urokinase receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLAUR
Synonyms (NCBI Gene) Gene synonyms aliases
CD87, U-PAR, UPAR, URKR
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized deg
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005839 hsa-miR-204-5p Microarray 21282569
MIRT020661 hsa-miR-155-5p Proteomics 18668040
MIRT031606 hsa-miR-16-5p Proteomics 18668040
MIRT1239464 hsa-miR-1200 CLIP-seq
MIRT1239465 hsa-miR-1208 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ATF1 Unknown 12369939
EGR1 Activation 21283769
ETV4 Unknown 11234878
FOS Unknown 10471035
FOSL1 Unknown 10471035;11234878
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IMP 22984561
GO:0005102 Function Signaling receptor binding IPI 12665524
GO:0005515 Function Protein binding IPI 11290596, 14764453, 15922359, 18376415, 18718938, 24457100, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
173391 9053 ENSG00000011422
Protein
UniProt ID Q03405
Protein name Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)
Protein function Acts as a receptor for urokinase plasminogen activator (PubMed:15677461). Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-
PDB 1YWH , 2FD6 , 2I9B , 3BT1 , 3BT2 , 3U73 , 3U74 , 4K24 , 4QTI , 7E17 , 7V63
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 25 99 u-PAR/Ly-6 domain Domain
PF00021 UPAR_LY6 216 294 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCN
QGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCN
HPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Complement and coagulation cascades
Proteoglycans in cancer
  Attachment of GPI anchor to uPAR
Neutrophil degranulation
Dissolution of Fibrin Clot
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acantholysis Associate 9347794
Acute erythroleukemia Associate 15849776
Adenocarcinoma Associate 32048177
Adenocarcinoma of Lung Associate 22529186, 23287851, 29961070, 37795779, 37880277
Adenoma Associate 20496126, 9824607
Airway Obstruction Associate 23806081
Airway Remodeling Associate 22139533, 25041788, 26869673
Ameloblastoma Associate 36507758
Angioedemas Hereditary Stimulate 29729940
Arthritis Associate 8646430, 9215148