Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5327
Gene name	Plasminogen activator, tissue type
Gene symbol	PLAT
Synonyms (NCBI Gene)	T-PATPA
Chromosome	8
Chromosome location	8p11.21
Summary	This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and l

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114878147	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

198

Show/Hide all (198)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005838	hsa-miR-204-5p	Microarray	21282569
MIRT005953	hsa-miR-21-5p	Luciferase reporter assayMicroarrayqRT-PCR	21131358
MIRT017829	hsa-miR-335-5p	Microarray	18185580
MIRT735970	hsa-miR-142-5p	MicroarrayqRT-PCR	31552107
MIRT1239429	hsa-miR-1178	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT1239431	hsa-miR-1324	CLIP-seq
MIRT1239432	hsa-miR-186	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT1239434	hsa-miR-3133	CLIP-seq
MIRT1239435	hsa-miR-3182	CLIP-seq
MIRT1239436	hsa-miR-3185	CLIP-seq
MIRT1239437	hsa-miR-320a	CLIP-seq
MIRT1239438	hsa-miR-320b	CLIP-seq
MIRT1239439	hsa-miR-320c	CLIP-seq
MIRT1239440	hsa-miR-320d	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239442	hsa-miR-340	CLIP-seq
MIRT1239443	hsa-miR-3622b-5p	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT1239450	hsa-miR-4429	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT1239454	hsa-miR-4695-3p	CLIP-seq
MIRT1239455	hsa-miR-4701-5p	CLIP-seq
MIRT1239456	hsa-miR-4711-3p	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT1239458	hsa-miR-542-3p	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT1239461	hsa-miR-588	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT1239463	hsa-miR-767-3p	CLIP-seq
MIRT1239442	hsa-miR-340	CLIP-seq
MIRT2432149	hsa-miR-4509	CLIP-seq
MIRT2432150	hsa-miR-4666-3p	CLIP-seq
MIRT2432151	hsa-miR-4744	CLIP-seq
MIRT2432152	hsa-miR-4768-5p	CLIP-seq
MIRT2432153	hsa-miR-561	CLIP-seq
MIRT1239429	hsa-miR-1178	CLIP-seq
MIRT2594990	hsa-miR-1224-5p	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT2594991	hsa-miR-1291	CLIP-seq
MIRT2594992	hsa-miR-1304	CLIP-seq
MIRT2594993	hsa-miR-1587	CLIP-seq
MIRT2594994	hsa-miR-1913	CLIP-seq
MIRT2594995	hsa-miR-193a-5p	CLIP-seq
MIRT2594996	hsa-miR-2110	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT2594997	hsa-miR-3137	CLIP-seq
MIRT2594998	hsa-miR-3140-3p	CLIP-seq
MIRT2594999	hsa-miR-3140-5p	CLIP-seq
MIRT2595000	hsa-miR-3147	CLIP-seq
MIRT2595001	hsa-miR-3153	CLIP-seq
MIRT2595002	hsa-miR-3160-5p	CLIP-seq
MIRT2595003	hsa-miR-3173-5p	CLIP-seq
MIRT2595004	hsa-miR-3189-5p	CLIP-seq
MIRT2595005	hsa-miR-3194-5p	CLIP-seq
MIRT1239437	hsa-miR-320a	CLIP-seq
MIRT1239438	hsa-miR-320b	CLIP-seq
MIRT1239439	hsa-miR-320c	CLIP-seq
MIRT1239440	hsa-miR-320d	CLIP-seq
MIRT2595006	hsa-miR-324-3p	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239443	hsa-miR-3622b-5p	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT2595007	hsa-miR-3691-3p	CLIP-seq
MIRT2595008	hsa-miR-370	CLIP-seq
MIRT2595009	hsa-miR-378g	CLIP-seq
MIRT2595010	hsa-miR-3915	CLIP-seq
MIRT2595011	hsa-miR-3928	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT2595012	hsa-miR-4271	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT2595013	hsa-miR-4428	CLIP-seq
MIRT1239450	hsa-miR-4429	CLIP-seq
MIRT2595014	hsa-miR-4433	CLIP-seq
MIRT2595015	hsa-miR-4434	CLIP-seq
MIRT2595016	hsa-miR-4437	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT2595017	hsa-miR-4459	CLIP-seq
MIRT2595018	hsa-miR-4481	CLIP-seq
MIRT2432149	hsa-miR-4509	CLIP-seq
MIRT2595019	hsa-miR-4516	CLIP-seq
MIRT2595020	hsa-miR-4531	CLIP-seq
MIRT2595021	hsa-miR-4533	CLIP-seq
MIRT2595022	hsa-miR-4640-5p	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT2432150	hsa-miR-4666-3p	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT2595023	hsa-miR-4674	CLIP-seq
MIRT2595024	hsa-miR-4689	CLIP-seq
MIRT2595025	hsa-miR-4698	CLIP-seq
MIRT1239455	hsa-miR-4701-5p	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT2595026	hsa-miR-4725-3p	CLIP-seq
MIRT2595027	hsa-miR-4726-5p	CLIP-seq
MIRT2595028	hsa-miR-4731-3p	CLIP-seq
MIRT2595029	hsa-miR-4731-5p	CLIP-seq
MIRT2595030	hsa-miR-4732-5p	CLIP-seq
MIRT2432151	hsa-miR-4744	CLIP-seq
MIRT2595031	hsa-miR-4745-5p	CLIP-seq
MIRT2595032	hsa-miR-4747-5p	CLIP-seq
MIRT2595033	hsa-miR-4758-3p	CLIP-seq
MIRT2595034	hsa-miR-4763-5p	CLIP-seq
MIRT2595035	hsa-miR-4768-3p	CLIP-seq
MIRT2432152	hsa-miR-4768-5p	CLIP-seq
MIRT2595036	hsa-miR-4797-5p	CLIP-seq
MIRT2595037	hsa-miR-4801	CLIP-seq
MIRT2595038	hsa-miR-491-5p	CLIP-seq
MIRT2595039	hsa-miR-516b	CLIP-seq
MIRT2595040	hsa-miR-541	CLIP-seq
MIRT1239458	hsa-miR-542-3p	CLIP-seq
MIRT2432153	hsa-miR-561	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT1239461	hsa-miR-588	CLIP-seq
MIRT2595041	hsa-miR-596	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT2595042	hsa-miR-654-5p	CLIP-seq
MIRT1239463	hsa-miR-767-3p	CLIP-seq
MIRT2594990	hsa-miR-1224-5p	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT2594991	hsa-miR-1291	CLIP-seq
MIRT2594992	hsa-miR-1304	CLIP-seq
MIRT2594993	hsa-miR-1587	CLIP-seq
MIRT2594994	hsa-miR-1913	CLIP-seq
MIRT2594995	hsa-miR-193a-5p	CLIP-seq
MIRT2594996	hsa-miR-2110	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT2594997	hsa-miR-3137	CLIP-seq
MIRT2594998	hsa-miR-3140-3p	CLIP-seq
MIRT2594999	hsa-miR-3140-5p	CLIP-seq
MIRT2595000	hsa-miR-3147	CLIP-seq
MIRT2595001	hsa-miR-3153	CLIP-seq
MIRT2595002	hsa-miR-3160-5p	CLIP-seq
MIRT2595003	hsa-miR-3173-5p	CLIP-seq
MIRT2595004	hsa-miR-3189-5p	CLIP-seq
MIRT2595005	hsa-miR-3194-5p	CLIP-seq
MIRT2595006	hsa-miR-324-3p	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT2595007	hsa-miR-3691-3p	CLIP-seq
MIRT2595008	hsa-miR-370	CLIP-seq
MIRT2595009	hsa-miR-378g	CLIP-seq
MIRT2595010	hsa-miR-3915	CLIP-seq
MIRT2595011	hsa-miR-3928	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT2595012	hsa-miR-4271	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT2595013	hsa-miR-4428	CLIP-seq
MIRT2595014	hsa-miR-4433	CLIP-seq
MIRT2595015	hsa-miR-4434	CLIP-seq
MIRT2595016	hsa-miR-4437	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT2595017	hsa-miR-4459	CLIP-seq
MIRT2595018	hsa-miR-4481	CLIP-seq
MIRT2595019	hsa-miR-4516	CLIP-seq
MIRT2595020	hsa-miR-4531	CLIP-seq
MIRT2595021	hsa-miR-4533	CLIP-seq
MIRT2595022	hsa-miR-4640-5p	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT2595023	hsa-miR-4674	CLIP-seq
MIRT2595024	hsa-miR-4689	CLIP-seq
MIRT2595025	hsa-miR-4698	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT2595026	hsa-miR-4725-3p	CLIP-seq
MIRT2595027	hsa-miR-4726-5p	CLIP-seq
MIRT2595028	hsa-miR-4731-3p	CLIP-seq
MIRT2595029	hsa-miR-4731-5p	CLIP-seq
MIRT2595031	hsa-miR-4745-5p	CLIP-seq
MIRT2595032	hsa-miR-4747-5p	CLIP-seq
MIRT2595033	hsa-miR-4758-3p	CLIP-seq
MIRT2595034	hsa-miR-4763-5p	CLIP-seq
MIRT2595035	hsa-miR-4768-3p	CLIP-seq
MIRT2595036	hsa-miR-4797-5p	CLIP-seq
MIRT2595037	hsa-miR-4801	CLIP-seq
MIRT2595038	hsa-miR-491-5p	CLIP-seq
MIRT2595039	hsa-miR-516b	CLIP-seq
MIRT2595040	hsa-miR-541	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT2595041	hsa-miR-596	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT2595042	hsa-miR-654-5p	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
ATF2	Activation	8647095
CREB1	Repression	8647095
CREM	Unknown	9851700
JUN	Activation	1963081
JUN	Unknown	9851700
JUND	Unknown	9851700
NF1	Repression	15044208
SP1	Unknown	21437359;9851700
SP3	Unknown	21437359

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1695900, 8508955
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	8186264
GO:0005515	Function	Protein binding	IPI	2503541, 10340997, 12694198, 24196407, 33961781, 39294191
GO:0005515	Function	Protein binding	TAS	8186264
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	1632457
GO:0005737	Component	Cytoplasm	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	3087818
GO:0007596	Process	Blood coagulation	TAS	3839198
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	1632457
GO:0010757	Process	Negative regulation of plasminogen activation	NAS	8508955
GO:0014909	Process	Smooth muscle cell migration	IBA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0031012	Component	Extracellular matrix	IDA	1632457
GO:0031638	Process	Zymogen activation	IEA
GO:0031639	Process	Plasminogen activation	IBA
GO:0031639	Process	Plasminogen activation	IDA	12694198, 17849409, 24196407
GO:0031639	Process	Plasminogen activation	IEA
GO:0036211	Process	Protein modification process	TAS	3087818
GO:0042730	Process	Fibrinolysis	TAS
GO:0045177	Component	Apical part of cell	IEA
GO:0045861	Process	Negative regulation of proteolysis	IDA	1695900
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	8186264
GO:0051918	Process	Negative regulation of fibrinolysis	NAS	8508955
GO:0060468	Process	Prevention of polyspermy	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097180	Component	Serine protease inhibitor complex	IPI	26324706
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099183	Process	Trans-synaptic signaling by BDNF, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
173370	9051	ENSG00000104368

P00750

Protein name

Tissue-type plasminogen activator (t-PA) (t-plasminogen activator) (tPA) (EC 3.4.21.68) (Alteplase) (Reteplase) [Cleaved into: Tissue-type plasminogen activator chain A; Tissue-type plasminogen activator chain B]

Protein function

Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migrat

PDB

1A5H , 1BDA , 1PK2 , 1PML , 1RTF , 1TPG , 1TPK , 1TPM , 1TPN , 5BRR , 5ZLZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00039	fn1	41 → 78	Fibronectin type I domain	Domain
PF00008	EGF	86 → 117	EGF-like domain	Domain
PF00051	Kringle	127 → 208	Kringle domain	Domain
PF00051	Kringle	215 → 296	Kringle domain	Domain
PF00089	Trypsin	311 → 556	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.

Sequence

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP

Sequence length

562

Interactions

View interactions

	KEGG		Reactome
	Apelin signaling pathway Complement and coagulation cascades Transcriptional misregulation in cancer Prostate cancer Fluid shear stress and atherosclerosis		Signaling by PDGF Dissolution of Fibrin Clot

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormal bleeding	Uncertain significance	rs61755432, rs151006962	RCV001270618 RCV001270582
Deep venous thrombosis	Uncertain significance	rs1587928114, rs367827951	RCV000851678 RCV000852234
Hereditary angioedema with normal C1Inh	not provided	rs1587927986	RCV001027419
PLAT-related disorder	Likely benign	rs114878147	RCV003935797
Pulmonary embolism	Uncertain significance	rs367827951	RCV000852234
Sarcoma	Uncertain significance	rs61231575	RCV005930824
Thrombocytopenia	Uncertain significance	rs61755432, rs151006962	RCV001270618 RCV001270582

Show/Hide Text Mining Associations (140)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	17632087
Adenoma	Associate	9006343
Allergic Fungal Sinusitis	Inhibit	23155140
Angina Pectoris Variant	Associate	8130024
Aortic Aneurysm Abdominal	Stimulate	17543671
Aortic Aneurysm Abdominal	Associate	24452721, 7552526, 7615837
Aortic Dissection	Associate	9013920
Arterial Occlusive Diseases	Associate	12643326
Arterial Occlusive Diseases	Stimulate	25069814
Arthritis Rheumatoid	Associate	16356191, 9370880
Arthritis Rheumatoid	Inhibit	8646430
Atherosclerosis	Associate	25807501, 8300642
Autism Spectrum Disorder	Associate	27957319
Blister	Associate	15008985
Brain Ischemia	Associate	34796748
Breast Neoplasms	Inhibit	19407555
Breast Neoplasms	Associate	25728938, 26339655, 37338518, 37753740, 38237862, 8394731
Calcinosis Cutis	Associate	37753740
Carcinoma Non Small Cell Lung	Associate	23334061
Carcinoma Renal Cell	Associate	15086463
Cerebral Arterial Diseases	Associate	22235876
Cerebral Hemorrhage	Stimulate	38103737, 9559429
Cerebral Infarction	Associate	15911618, 17723126
Cerebral Infarction	Inhibit	22178875, 23360689, 30404981, 32568648, 37986378, 38103737
Cerebrovascular Disorders	Associate	34796748
Colorectal Adenomatous Polyposis Autosomal Recessive	Associate	9006343
Colorectal Neoplasms	Associate	10763140
Coronary Artery Disease	Associate	21034162
Coronary Disease	Associate	22235876
COVID 19	Associate	33173052, 34021237, 35780481
Coxa Magna	Associate	24025446
Cryoglobulinemia Familial Mixed	Stimulate	17393409
Diabetes Mellitus	Associate	31104419
Diabetes Mellitus Type 2	Inhibit	22577291
Diabetes Mellitus Type 2	Stimulate	23249721
Diabetes Mellitus Type 2	Associate	26420861
Diastrophic dysplasia	Stimulate	12643326
Diastrophic dysplasia	Inhibit	15055254
Disease	Stimulate	8601722
Disease Progression	Inhibit	26067893, 35728655
Duodenal Ulcer	Associate	12589088
Dyslipidemias	Associate	17723126
Edema	Associate	34796748
Epilepsy	Associate	15291813
Epilepsy Temporal Lobe	Associate	30669988
Esophageal Squamous Cell Carcinoma	Associate	31638164
Fibrosarcoma	Associate	3137305
Fractures Spontaneous	Associate	9815150
Glioblastoma	Associate	39179711
Glioma	Associate	16357523, 18492260, 39179711
Heart Defects Congenital	Associate	9104984
Heart Diseases	Associate	21219580
Heart Failure	Associate	15604328
Hemolytic Uremic Syndrome	Inhibit	33641611
Hemorrhage	Stimulate	2953770, 33723576, 38103737
Hemorrhage	Inhibit	32281768
Hyperglycemia	Associate	26420861
Hypertension	Stimulate	39595551
Hyperthyroidism	Associate	34210154
Hypothyroidism	Associate	34210154
Ichthyosis Vulgaris	Stimulate	8601722
Infarction Middle Cerebral Artery	Associate	17723126
Infections	Associate	17761618
Inflammation	Inhibit	36947703
Insulin Resistance	Associate	26420861, 35806251
Invasive Pulmonary Aspergillosis	Associate	24712925
Ischemic Stroke	Inhibit	38272772
Leg Ulcer	Associate	10954203
Leukemia Lymphocytic Chronic B Cell	Associate	3872753
Leukemia Prolymphocytic T Cell	Stimulate	3872753
Leukemia Promyelocytic Acute	Associate	10099141
Liver Cirrhosis Biliary	Associate	2442199
Liver Diseases Alcoholic	Associate	2442199
Lung Neoplasms	Associate	21398193
Lymphatic Metastasis	Associate	26150443, 37753740
Melanoma	Associate	11044361, 2117440, 27973546, 8034604
Melanoma	Stimulate	23063511
Metabolic Syndrome	Inhibit	22577291
Mouth Diseases	Stimulate	8601722
Multiple Myeloma	Associate	21733935
Multiple Sclerosis	Associate	15793294
Myocardial Infarction	Associate	15119966, 15466927, 21624046
Myocardial Infarction	Stimulate	15670033
Myocardial Infarction	Inhibit	2953770, 8874999, 9559429
Myocardial Ischemia	Associate	34796748
Myotonic Dystrophy	Stimulate	11422656
Nasal Polyps	Associate	23155140, 26067893, 36841712
Nasal Polyps	Inhibit	29431874, 35728655
Neoplasm Metastasis	Associate	11044361, 21859479, 32844403
Neoplasms	Associate	10763140, 11044361, 15816639, 16357523, 21113744, 2167321, 21859479, 2466035, 26339655, 27689401, 28108419, 37753740, 38237862, 39179711, 39595551
Neoplasms	Stimulate	4039726
Nevus	Stimulate	23063511
Osteoarthritis	Inhibit	8646430
Osteoarthritis	Associate	9370880
Pancreatic Neoplasms	Associate	16733850, 17452424, 8641471
Pemphigoid Bullous	Stimulate	15008985, 2121833, 8601722
Pemphigus	Stimulate	2121833, 8601722
Pemphigus Benign Familial	Stimulate	2121833, 8601722
Peptic Ulcer	Associate	12589088
Peritonitis	Associate	11044361
Placenta Previa	Associate	37434137
Plasminogen Activator Inhibitor 1 Deficiency	Associate	34538821
Pleural Diseases	Associate	31673364
Polycystic Ovary Syndrome	Associate	17661167
Pre Eclampsia	Associate	25879409, 37434137, 37545924
Prostatic Neoplasms	Associate	2466035, 26296974, 27689401, 28108419
Prostatic Neoplasms Castration Resistant	Associate	28108419
Prostatitis	Associate	2466035, 27689401
Psoriasis	Stimulate	2121833, 8601722
Pulmonary Disease Chronic Obstructive	Stimulate	40243422
Pulmonary Embolism	Associate	30635605
Schizophrenia	Inhibit	27957319
Sick Sinus Syndrome	Associate	8394731
Sinus Thrombosis Intracranial	Inhibit	30635218
Sleep Apnea Obstructive	Associate	24497664, 35887329
smoker's inclusion bodies	Stimulate	40243422
Squamous Cell Carcinoma of Head and Neck	Associate	11437413
ST Elevation Myocardial Infarction	Associate	21624046
Stomach Neoplasms	Associate	39762768
Stroke	Inhibit	25862260
Stroke	Associate	34252155
Subarachnoid Hemorrhage	Associate	31268630
Telangiectasis	Associate	10954203
Thoracic Diseases	Associate	23334061
Thrombocythemia Essential	Associate	25989112
Thrombosis	Associate	11038326, 18258816, 33173052
Thrombosis	Inhibit	36044519
Thrombosis	Stimulate	7776475
Thrombotic Microangiopathies	Associate	8943484
Triple Negative Breast Neoplasms	Associate	37753740
Urinary Bladder Neoplasms	Associate	15816639
Uterine Cervical Dysplasia	Associate	10686539
Vascular Diseases	Associate	25807501, 7776475
Vascular System Injuries	Associate	8300642
Venous Insufficiency	Inhibit	10954203
Venous Thromboembolism	Associate	33512476, 37762110, 39179711
Venous Thrombosis	Inhibit	25837651
Vulvar Neoplasms	Associate	10686539
Wolfram Like Syndrome Autosomal Dominant	Associate	21624046
Wounds and Injuries	Associate	29190254

PLAT (plasminogen activator, tissue type)