Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5325
Gene name	PLAG1 like zinc finger 1
Gene symbol	PLAGL1
Synonyms (NCBI Gene)	LOT1ZACZAC1
Chromosome	6
Chromosome location	6q24.2
Summary	This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causa

Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027731	hsa-miR-98-5p	Microarray	19088304
MIRT736255	hsa-miR-379-3p	Luciferase reporter assayWestern blottingMicroarrayNorthern blottingqRT-PCRFlow cytometry	32032531
MIRT736256	hsa-miR-410-3p	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCRFlow cytometry	32032531
MIRT1239101	hsa-miR-125a-5p	CLIP-seq
MIRT1239102	hsa-miR-125b	CLIP-seq
MIRT1239103	hsa-miR-1270	CLIP-seq
MIRT1239104	hsa-miR-15a	CLIP-seq
MIRT1239105	hsa-miR-15b	CLIP-seq
MIRT1239106	hsa-miR-16	CLIP-seq
MIRT1239107	hsa-miR-195	CLIP-seq
MIRT1239108	hsa-miR-338-5p	CLIP-seq
MIRT1239109	hsa-miR-3927	CLIP-seq
MIRT1239110	hsa-miR-424	CLIP-seq
MIRT1239111	hsa-miR-425	CLIP-seq
MIRT1239112	hsa-miR-4319	CLIP-seq
MIRT1239113	hsa-miR-4434	CLIP-seq
MIRT1239114	hsa-miR-4516	CLIP-seq
MIRT1239115	hsa-miR-4524	CLIP-seq
MIRT1239116	hsa-miR-4531	CLIP-seq
MIRT1239117	hsa-miR-4650-3p	CLIP-seq
MIRT1239118	hsa-miR-4668-3p	CLIP-seq
MIRT1239119	hsa-miR-4732-3p	CLIP-seq
MIRT1239120	hsa-miR-4764-5p	CLIP-seq
MIRT1239121	hsa-miR-4781-3p	CLIP-seq
MIRT1239122	hsa-miR-493	CLIP-seq
MIRT1239123	hsa-miR-497	CLIP-seq
MIRT1239124	hsa-miR-503	CLIP-seq
MIRT1239125	hsa-miR-539	CLIP-seq
MIRT1239126	hsa-miR-548c-3p	CLIP-seq
MIRT1239127	hsa-miR-605	CLIP-seq
MIRT1239128	hsa-miR-620	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq
MIRT1239130	hsa-miR-670	CLIP-seq
MIRT1239131	hsa-miR-105	CLIP-seq
MIRT1239132	hsa-miR-4325	CLIP-seq
MIRT1239133	hsa-miR-520d-5p	CLIP-seq
MIRT1239134	hsa-miR-524-5p	CLIP-seq
MIRT1239101	hsa-miR-125a-5p	CLIP-seq
MIRT1239102	hsa-miR-125b	CLIP-seq
MIRT1239112	hsa-miR-4319	CLIP-seq
MIRT1239135	hsa-miR-4672	CLIP-seq
MIRT1239119	hsa-miR-4732-3p	CLIP-seq
MIRT1239130	hsa-miR-670	CLIP-seq
MIRT1239136	hsa-miR-335	CLIP-seq
MIRT1239137	hsa-miR-1271	CLIP-seq
MIRT1239138	hsa-miR-3664-3p	CLIP-seq
MIRT1239139	hsa-miR-4436a	CLIP-seq
MIRT1239140	hsa-miR-490-3p	CLIP-seq
MIRT1239141	hsa-miR-510	CLIP-seq
MIRT1239142	hsa-miR-649	CLIP-seq
MIRT1239143	hsa-miR-96	CLIP-seq
MIRT1239103	hsa-miR-1270	CLIP-seq
MIRT1239113	hsa-miR-4434	CLIP-seq
MIRT1239114	hsa-miR-4516	CLIP-seq
MIRT1239116	hsa-miR-4531	CLIP-seq
MIRT1239135	hsa-miR-4672	CLIP-seq
MIRT2070313	hsa-miR-513c	CLIP-seq
MIRT2070314	hsa-miR-514b-5p	CLIP-seq
MIRT1239125	hsa-miR-539	CLIP-seq
MIRT1239128	hsa-miR-620	CLIP-seq
MIRT2432147	hsa-miR-3658	CLIP-seq
MIRT2432148	hsa-miR-4662a-3p	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq
MIRT1239104	hsa-miR-15a	CLIP-seq
MIRT1239105	hsa-miR-15b	CLIP-seq
MIRT1239106	hsa-miR-16	CLIP-seq
MIRT1239107	hsa-miR-195	CLIP-seq
MIRT2688000	hsa-miR-2114	CLIP-seq
MIRT1239108	hsa-miR-338-5p	CLIP-seq
MIRT1239110	hsa-miR-424	CLIP-seq
MIRT1239111	hsa-miR-425	CLIP-seq
MIRT2688001	hsa-miR-4420	CLIP-seq
MIRT2688002	hsa-miR-4427	CLIP-seq
MIRT1239115	hsa-miR-4524	CLIP-seq
MIRT2688003	hsa-miR-4676-5p	CLIP-seq
MIRT2688004	hsa-miR-4753-3p	CLIP-seq
MIRT1239120	hsa-miR-4764-5p	CLIP-seq
MIRT1239121	hsa-miR-4781-3p	CLIP-seq
MIRT1239123	hsa-miR-497	CLIP-seq
MIRT1239124	hsa-miR-503	CLIP-seq
MIRT2070313	hsa-miR-513c	CLIP-seq
MIRT2070314	hsa-miR-514b-5p	CLIP-seq
MIRT2688005	hsa-miR-575	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TP53	Unknown	11896574

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	9671765
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9671765
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IDA	15888726
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006915	Process	Apoptotic process	TAS	9671765
GO:0008270	Function	Zinc ion binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016604	Component	Nuclear body	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15888726
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9671765
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	9184226

MIM	HGNC	e!Ensembl
603044	9046	ENSG00000118495

Q9UM63

Protein name

Zinc finger protein PLAGL1 (Lost on transformation 1) (LOT-1) (Pleiomorphic adenoma-like protein 1) (Tumor suppressor ZAC)

Protein function

Acts as a transcriptional activator (PubMed:9722527). Involved in the transcriptional regulation of type 1 receptor for pituitary adenylate cyclase-activating polypeptide.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	32 → 56	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	62 → 84	Zinc finger, C2H2 type	Domain

Sequence

MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR

Sequence length

463

Interactions

View interactions

	Reactome
			TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign	rs72546304	RCV005938657
Colorectal cancer	Benign	rs72546304	RCV005938658
Gastric cancer	Benign	rs72546304	RCV005938660
Malignant tumor of esophagus	Benign	rs72546304	RCV005938656
Melanoma	Benign	rs72546304	RCV005938662
Myoepithelial tumor	Uncertain significance	rs2533852862	RCV002463945
Ovarian serous cystadenocarcinoma	Benign	rs72546304	RCV005938661
PLAGL1-related disorder	Benign; Likely benign	rs72546304, rs539999694, rs370394316, rs147054773, rs36120645, rs17073229, rs17847328	RCV003919782 RCV003943876 RCV003981811 RCV003935939 RCV003978388 RCV003916194 RCV003975748
Sarcoma	Benign	rs72546304	RCV005938659

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	37699152
Acromegaly	Associate	19637311
Arthritis Psoriatic	Associate	26633653
Beckwith Wiedemann Syndrome	Associate	19092779, 26505556
Breast Neoplasms	Associate	11297535, 28791367, 36788602
Breast Neoplasms	Inhibit	32678267
Capillary Malformation Arteriovenous Malformation	Associate	32693431
Carcinogenesis	Associate	16179495, 28957425
Carcinoma	Associate	24260468
Carcinoma Basal Cell	Inhibit	16179495, 32678267
Carcinoma Non Small Cell Lung	Associate	12878869
Carcinoma Squamous Cell	Associate	16179495
Central Nervous System Neoplasms	Associate	36437415
Chorioamnionitis	Associate	23477525
Chromosome Aberrations	Associate	16971482
Chronic Disease	Associate	23477525
Clear cell metastatic renal cell carcinoma	Associate	32678267
Condylomata Acuminata	Associate	28810862
Developmental Disabilities	Associate	24316753
Diabetes Mellitus	Associate	12473647, 24316753, 24993786
Diabetes Mellitus Transient Neonatal 1	Associate	11297535, 19092779, 24316753, 28957425
Diabetes Mellitus Transient Neonatal 1	Stimulate	27075368
Ependymoma	Associate	34355256, 39228008
Fetal Growth Retardation	Associate	19483473, 24993786
Fibroma	Associate	20696777
Growth Disorders	Associate	12473647, 24316753
Heart Defects Congenital	Associate	22784302, 32693431, 33407475
Heart Septal Defects Ventricular	Associate	22784302
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	12473647, 16179495
Infant Premature Diseases	Associate	36788602
Leiomyosarcoma	Associate	24260468
Lung Neoplasms	Associate	12878869
Neoplasm Metastasis	Associate	24260468
Neoplasms	Associate	11297535, 23477525, 28957425, 34355256, 36437415
Neoplasms	Inhibit	12473647, 16179495, 19637311, 20696777, 23890537, 24260468, 32678267
Neoplasms Neuroepithelial	Associate	39228008
Obesity	Associate	24158121
Obesity Maternal	Associate	24158121
Ovarian Neoplasms	Inhibit	32678267
Pancreatic Neoplasms	Inhibit	36600208
Paroxysmal ventricular fibrillation	Associate	27178226
Pediatric Obesity	Associate	23477525
Pituitary Neoplasms	Associate	19637311
Pituitary Neoplasms	Inhibit	24098585, 32678267
Premature Birth	Associate	23477525, 36788602
Prostatic Neoplasms	Associate	24513574
Prostatitis	Associate	23890537
Pseudohypoparathyroidism Type 1B	Associate	19092779
Riboflavin Deficiency	Stimulate	16109485
Sarcoma	Associate	24260468
Silver Russell Syndrome	Associate	32546215
Stomach Neoplasms	Associate	16367923, 17552003
Supratentorial Neoplasms	Associate	34355256
Uterine Cervical Neoplasms	Associate	18217980
Uterine Cervical Neoplasms	Inhibit	32678267

PLAGL1 (PLAG1 like zinc finger 1)