Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5325
Gene name Gene Name - the full gene name approved by the HGNC.
PLAG1 like zinc finger 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLAGL1
Synonyms (NCBI Gene) Gene synonyms aliases
LOT1, ZAC, ZAC1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causa
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027731 hsa-miR-98-5p Microarray 19088304
MIRT736255 hsa-miR-379-3p Luciferase reporter assay, Western blotting, Microarray, Northern blotting, qRT-PCR, Flow cytometry 32032531
MIRT736256 hsa-miR-410-3p Luciferase reporter assay, Western blotting, Northern blotting, qRT-PCR, Flow cytometry 32032531
MIRT1239101 hsa-miR-125a-5p CLIP-seq
MIRT1239102 hsa-miR-125b CLIP-seq
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 11896574
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9671765
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603044 9046 ENSG00000118495
Protein
UniProt ID Q9UM63
Protein name Zinc finger protein PLAGL1 (Lost on transformation 1) (LOT-1) (Pleiomorphic adenoma-like protein 1) (Tumor suppressor ZAC)
Protein function Acts as a transcriptional activator (PubMed:9722527). Involved in the transcriptional regulation of type 1 receptor for pituitary adenylate cyclase-activating polypeptide.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 32 56 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 62 84 Zinc finger, C2H2 type Domain
Sequence
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Sequence length 463
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (adult onset) N/A N/A GWAS
Diabetes Mellitus transient neonatal diabetes mellitus N/A N/A GenCC
Leprosy Leprosy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 37699152
Acromegaly Associate 19637311
Arthritis Psoriatic Associate 26633653
Beckwith Wiedemann Syndrome Associate 19092779, 26505556
Breast Neoplasms Associate 11297535, 28791367, 36788602
Breast Neoplasms Inhibit 32678267
Capillary Malformation Arteriovenous Malformation Associate 32693431
Carcinogenesis Associate 16179495, 28957425
Carcinoma Associate 24260468
Carcinoma Basal Cell Inhibit 16179495, 32678267